BLASTX nr result
ID: Lithospermum23_contig00017426
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00017426 (277 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ONK79166.1 uncharacterized protein A4U43_C01F3600 [Asparagus off... 52 2e-06 >ONK79166.1 uncharacterized protein A4U43_C01F3600 [Asparagus officinalis] Length = 124 Score = 52.0 bits (123), Expect = 2e-06 Identities = 26/59 (44%), Positives = 40/59 (67%), Gaps = 4/59 (6%) Frame = -1 Query: 262 EMNNDPMENEQTEDDDNLVEGNKDQ----EVITTIGTSNEWIQFRANMAIDMFNTWQAS 98 E+ NDP E ++ E+ + + EG +++ E IT++GTSNEW QFRA++ M+N W AS Sbjct: 56 ELKNDPFEIDKLEEYE-VEEGEQNEKNEVETITSMGTSNEWFQFRADLGSIMYNHWLAS 113