BLASTX nr result
ID: Lithospermum23_contig00016969
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00016969 (203 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012082025.1 PREDICTED: NAC domain-containing protein 8 [Jatro... 55 4e-07 AFN55269.1 NAC domain-containing protein [Tamarix hispida] 51 7e-06 >XP_012082025.1 PREDICTED: NAC domain-containing protein 8 [Jatropha curcas] AGL39748.1 NAC transcription factor 092 [Jatropha curcas] KDP29362.1 hypothetical protein JCGZ_18283 [Jatropha curcas] Length = 428 Score = 54.7 bits (130), Expect = 4e-07 Identities = 26/53 (49%), Positives = 29/53 (54%) Frame = +2 Query: 44 SSPTLISSEDHDDQAGDKNDYEAGEDSKWWDSEXXXXXXXXXXVEALSLCDEL 202 +S + EDH DQ D ND ED+KWWDSE VE LSLCDEL Sbjct: 296 NSDDKLKPEDHSDQMVDNNDNNIEEDTKWWDSESQNLFDSQQLVEGLSLCDEL 348 >AFN55269.1 NAC domain-containing protein [Tamarix hispida] Length = 441 Score = 51.2 bits (121), Expect = 7e-06 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 1/46 (2%) Frame = +2 Query: 68 EDH-DDQAGDKNDYEAGEDSKWWDSEXXXXXXXXXXVEALSLCDEL 202 E H D++A D N+ +AG+D+KWWDSE VEALSLCD+L Sbjct: 300 ESHLDEEAADCNNDQAGDDTKWWDSESQYLIDSQQLVEALSLCDDL 345