BLASTX nr result
ID: Lithospermum23_contig00016954
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00016954 (203 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004487027.1 PREDICTED: probable histone H2A.1 [Cicer arietinum] 56 3e-08 GAU27218.1 hypothetical protein TSUD_108090 [Trifolium subterran... 56 3e-08 GAU27220.1 hypothetical protein TSUD_108110 [Trifolium subterran... 55 6e-08 GAU27216.1 hypothetical protein TSUD_108070 [Trifolium subterran... 55 6e-08 XP_003597343.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] ... 54 2e-07 XP_003597346.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] ... 54 2e-07 GAU27219.1 hypothetical protein TSUD_108100 [Trifolium subterran... 54 2e-07 XP_019177345.1 PREDICTED: probable histone H2A.1 [Ipomoea nil] 54 2e-07 EMS56540.1 Histone H2A.2.2 [Triticum urartu] 52 3e-07 XP_016501209.1 PREDICTED: probable histone H2A.1 [Nicotiana taba... 54 3e-07 XP_009801696.1 PREDICTED: histone H2A [Nicotiana sylvestris] XP_... 54 3e-07 XP_009628436.1 PREDICTED: probable histone H2A.1 [Nicotiana tome... 54 3e-07 KYP58560.1 putative histone H2A.1 [Cajanus cajan] 53 4e-07 ONM40542.1 Histone H2A [Zea mays] 52 5e-07 XP_020171182.1 protein H2A.6-like [Aegilops tauschii subsp. taus... 53 5e-07 EMT31039.1 Protein H2A.6 [Aegilops tauschii] 53 5e-07 XP_003606634.1 histone H2A 6 [Medicago truncatula] AES88831.1 hi... 53 6e-07 XP_013456170.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] ... 53 6e-07 XP_013456141.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] ... 53 6e-07 XP_003606644.2 core histone H2A/H2B/H3/H4 [Medicago truncatula] ... 53 6e-07 >XP_004487027.1 PREDICTED: probable histone H2A.1 [Cicer arietinum] Length = 149 Score = 56.2 bits (134), Expect = 3e-08 Identities = 30/49 (61%), Positives = 30/49 (61%) Frame = +2 Query: 56 MDTVTKSTXXXXXXXXXXXXXXXVTRSNRAGLQFPVGRIGRYLKKGRYA 202 MDT KS VTRS RAGLQFPVGRIGRYLKKGRYA Sbjct: 1 MDTSPKSKRGAGGRKGGGPRKKAVTRSTRAGLQFPVGRIGRYLKKGRYA 49 >GAU27218.1 hypothetical protein TSUD_108090 [Trifolium subterraneum] Length = 151 Score = 56.2 bits (134), Expect = 3e-08 Identities = 29/49 (59%), Positives = 30/49 (61%) Frame = +2 Query: 56 MDTVTKSTXXXXXXXXXXXXXXXVTRSNRAGLQFPVGRIGRYLKKGRYA 202 MD TK+ VTRS RAGLQFPVGRIGRYLKKGRYA Sbjct: 1 MDATTKTKKGAGGRKGGGPRKKSVTRSTRAGLQFPVGRIGRYLKKGRYA 49 >GAU27220.1 hypothetical protein TSUD_108110 [Trifolium subterraneum] Length = 151 Score = 55.5 bits (132), Expect = 6e-08 Identities = 29/49 (59%), Positives = 29/49 (59%) Frame = +2 Query: 56 MDTVTKSTXXXXXXXXXXXXXXXVTRSNRAGLQFPVGRIGRYLKKGRYA 202 MD TK VTRS RAGLQFPVGRIGRYLKKGRYA Sbjct: 1 MDATTKPKKGAGGRKGGESRKKSVTRSTRAGLQFPVGRIGRYLKKGRYA 49 >GAU27216.1 hypothetical protein TSUD_108070 [Trifolium subterraneum] Length = 152 Score = 55.5 bits (132), Expect = 6e-08 Identities = 29/49 (59%), Positives = 30/49 (61%) Frame = +2 Query: 56 MDTVTKSTXXXXXXXXXXXXXXXVTRSNRAGLQFPVGRIGRYLKKGRYA 202 MD TK+ VTRS RAGLQFPVGRIGRYLKKGRYA Sbjct: 1 MDASTKTKKGAGGRKGGGPRKKSVTRSTRAGLQFPVGRIGRYLKKGRYA 49 >XP_003597343.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] Q2HU65.1 RecName: Full=Probable histone H2A.2 ABD32280.1 Histone H2A; Histone-fold [Medicago truncatula] AES67594.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] AFK48361.1 unknown [Medicago truncatula] AFK48541.1 unknown [Medicago truncatula] Length = 153 Score = 54.3 bits (129), Expect = 2e-07 Identities = 29/49 (59%), Positives = 30/49 (61%) Frame = +2 Query: 56 MDTVTKSTXXXXXXXXXXXXXXXVTRSNRAGLQFPVGRIGRYLKKGRYA 202 MD TK+ VTRS RAGLQFPVGRIGRYLKKGRYA Sbjct: 1 MDASTKTKKGAGGRKGGGPRKKSVTRSIRAGLQFPVGRIGRYLKKGRYA 49 >XP_003597346.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] Q2HU68.1 RecName: Full=Probable histone H2A.1 ABD32277.1 Histone H2A; Histone-fold [Medicago truncatula] AES67597.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] AFK47235.1 unknown [Medicago truncatula] Length = 148 Score = 53.9 bits (128), Expect = 2e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +2 Query: 125 VTRSNRAGLQFPVGRIGRYLKKGRYA 202 VTRS RAGLQFPVGRIGRYLKKGRYA Sbjct: 23 VTRSTRAGLQFPVGRIGRYLKKGRYA 48 >GAU27219.1 hypothetical protein TSUD_108100 [Trifolium subterraneum] Length = 150 Score = 53.9 bits (128), Expect = 2e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +2 Query: 125 VTRSNRAGLQFPVGRIGRYLKKGRYA 202 VTRS RAGLQFPVGRIGRYLKKGRYA Sbjct: 24 VTRSTRAGLQFPVGRIGRYLKKGRYA 49 >XP_019177345.1 PREDICTED: probable histone H2A.1 [Ipomoea nil] Length = 153 Score = 53.9 bits (128), Expect = 2e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +2 Query: 125 VTRSNRAGLQFPVGRIGRYLKKGRYA 202 VTRS RAGLQFPVGRIGRYLKKGRYA Sbjct: 24 VTRSTRAGLQFPVGRIGRYLKKGRYA 49 >EMS56540.1 Histone H2A.2.2 [Triticum urartu] Length = 63 Score = 51.6 bits (122), Expect = 3e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 125 VTRSNRAGLQFPVGRIGRYLKKGRYA 202 VTRS +AGLQFPVGRIGRYLKKGRYA Sbjct: 22 VTRSVKAGLQFPVGRIGRYLKKGRYA 47 >XP_016501209.1 PREDICTED: probable histone H2A.1 [Nicotiana tabacum] Length = 151 Score = 53.5 bits (127), Expect = 3e-07 Identities = 29/49 (59%), Positives = 30/49 (61%) Frame = +2 Query: 56 MDTVTKSTXXXXXXXXXXXXXXXVTRSNRAGLQFPVGRIGRYLKKGRYA 202 MDT K+ VTRS RAGLQFPVGRIGRYLKKGRYA Sbjct: 1 MDTSGKAKKGAAGRRVGGPKKKPVTRSVRAGLQFPVGRIGRYLKKGRYA 49 >XP_009801696.1 PREDICTED: histone H2A [Nicotiana sylvestris] XP_016469029.1 PREDICTED: histone H2A [Nicotiana tabacum] XP_019263024.1 PREDICTED: histone H2A [Nicotiana attenuata] OIT37416.1 putative histone h2a.2 [Nicotiana attenuata] Length = 151 Score = 53.5 bits (127), Expect = 3e-07 Identities = 29/49 (59%), Positives = 30/49 (61%) Frame = +2 Query: 56 MDTVTKSTXXXXXXXXXXXXXXXVTRSNRAGLQFPVGRIGRYLKKGRYA 202 MDT K+ VTRS RAGLQFPVGRIGRYLKKGRYA Sbjct: 1 MDTSGKAKKGAAGRRGGGPKKKPVTRSVRAGLQFPVGRIGRYLKKGRYA 49 >XP_009628436.1 PREDICTED: probable histone H2A.1 [Nicotiana tomentosiformis] Length = 151 Score = 53.5 bits (127), Expect = 3e-07 Identities = 29/49 (59%), Positives = 30/49 (61%) Frame = +2 Query: 56 MDTVTKSTXXXXXXXXXXXXXXXVTRSNRAGLQFPVGRIGRYLKKGRYA 202 MDT K+ VTRS RAGLQFPVGRIGRYLKKGRYA Sbjct: 1 MDTSGKAKKGAAGRRGGGPKKKPVTRSVRAGLQFPVGRIGRYLKKGRYA 49 >KYP58560.1 putative histone H2A.1 [Cajanus cajan] Length = 149 Score = 53.1 bits (126), Expect = 4e-07 Identities = 29/49 (59%), Positives = 29/49 (59%) Frame = +2 Query: 56 MDTVTKSTXXXXXXXXXXXXXXXVTRSNRAGLQFPVGRIGRYLKKGRYA 202 MDT K VTRS RAGLQFPVGRIGRYLKKGRYA Sbjct: 1 MDTTGKIKKGAGGRKGGGPKKKPVTRSVRAGLQFPVGRIGRYLKKGRYA 49 >ONM40542.1 Histone H2A [Zea mays] Length = 85 Score = 51.6 bits (122), Expect = 5e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 125 VTRSNRAGLQFPVGRIGRYLKKGRYA 202 VTRS +AGLQFPVGRIGRYLKKGRYA Sbjct: 29 VTRSVKAGLQFPVGRIGRYLKKGRYA 54 >XP_020171182.1 protein H2A.6-like [Aegilops tauschii subsp. tauschii] Length = 144 Score = 52.8 bits (125), Expect = 5e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +2 Query: 125 VTRSNRAGLQFPVGRIGRYLKKGRYA 202 VTRS RAGLQFPVGRIGRYLKKGRYA Sbjct: 13 VTRSVRAGLQFPVGRIGRYLKKGRYA 38 >EMT31039.1 Protein H2A.6 [Aegilops tauschii] Length = 144 Score = 52.8 bits (125), Expect = 5e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +2 Query: 125 VTRSNRAGLQFPVGRIGRYLKKGRYA 202 VTRS RAGLQFPVGRIGRYLKKGRYA Sbjct: 13 VTRSVRAGLQFPVGRIGRYLKKGRYA 38 >XP_003606634.1 histone H2A 6 [Medicago truncatula] AES88831.1 histone H2A 6 [Medicago truncatula] Length = 145 Score = 52.8 bits (125), Expect = 6e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +2 Query: 125 VTRSNRAGLQFPVGRIGRYLKKGRYA 202 VTRS RAGLQFPVGRIGRYLKKGRYA Sbjct: 19 VTRSIRAGLQFPVGRIGRYLKKGRYA 44 >XP_013456170.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] KEH30201.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] Length = 148 Score = 52.8 bits (125), Expect = 6e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +2 Query: 125 VTRSNRAGLQFPVGRIGRYLKKGRYA 202 VTRS RAGLQFPVGRIGRYLKKGRYA Sbjct: 25 VTRSIRAGLQFPVGRIGRYLKKGRYA 50 >XP_013456141.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] KEH30172.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] Length = 148 Score = 52.8 bits (125), Expect = 6e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +2 Query: 125 VTRSNRAGLQFPVGRIGRYLKKGRYA 202 VTRS RAGLQFPVGRIGRYLKKGRYA Sbjct: 25 VTRSIRAGLQFPVGRIGRYLKKGRYA 50 >XP_003606644.2 core histone H2A/H2B/H3/H4 [Medicago truncatula] AES88841.2 core histone H2A/H2B/H3/H4 [Medicago truncatula] Length = 148 Score = 52.8 bits (125), Expect = 6e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +2 Query: 125 VTRSNRAGLQFPVGRIGRYLKKGRYA 202 VTRS RAGLQFPVGRIGRYLKKGRYA Sbjct: 25 VTRSIRAGLQFPVGRIGRYLKKGRYA 50