BLASTX nr result
ID: Lithospermum23_contig00016402
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00016402 (650 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_009121970.1 ATPase subunit 6 (mitochondrion) [Hyoscyamus nige... 59 8e-09 YP_008992278.1 hypothetical protein Salmi_Mp012 (mitochondrion) ... 55 2e-06 >YP_009121970.1 ATPase subunit 6 (mitochondrion) [Hyoscyamus niger] AJK91366.1 ATPase subunit 6 (mitochondrion) [Hyoscyamus niger] Length = 395 Score = 58.9 bits (141), Expect(2) = 8e-09 Identities = 30/53 (56%), Positives = 36/53 (67%), Gaps = 4/53 (7%) Frame = +1 Query: 304 VLEGRPV----PPEEAWNAVDSPFYCSRAVHIPGEIEDPLTLSRLSKLNGFLM 450 VL+G PV P + W+ V SPFY S VHIPGEIEDPLT+ +LS N FL+ Sbjct: 15 VLQGIPVQDIFPDIDIWDIVSSPFYFSGTVHIPGEIEDPLTIVKLSDFNKFLV 67 Score = 28.9 bits (63), Expect(2) = 8e-09 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = +3 Query: 471 GGVMQAKNVRTIQQELDHTDANALPAKLESINSIIRMEYTRW 596 GGV+Q +++Q+ELD T L AKL+ + EY W Sbjct: 75 GGVIQPAYTQSLQRELDVTSEELLAAKLD---FMFNREYGFW 113 >YP_008992278.1 hypothetical protein Salmi_Mp012 (mitochondrion) [Salvia miltiorrhiza] AGU16547.1 hypothetical protein Salmi_Mp012 (mitochondrion) [Salvia miltiorrhiza] Length = 192 Score = 54.7 bits (130), Expect(2) = 2e-06 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 2/58 (3%) Frame = +1 Query: 283 TERKPPVVLEGRPVPPE--EAWNAVDSPFYCSRAVHIPGEIEDPLTLSRLSKLNGFLM 450 T P +L+G P+ E +AV SPFY + VHIPGEIE+PLT+ +L++LN FL+ Sbjct: 16 TSSSPSEILQGIPIQNLGIEESDAVSSPFYFAGVVHIPGEIENPLTVEKLTQLNHFLV 73 Score = 24.6 bits (52), Expect(2) = 2e-06 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 477 VMQAKNVRTIQQELDHTDANALPAKLE 557 ++Q+ + +Q ELD T A L AKL+ Sbjct: 83 IIQSSYTKFLQCELDQTPAELLSAKLD 109