BLASTX nr result
ID: Lithospermum23_contig00016315
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00016315 (329 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AQL07507.1 Two-component response regulator-like APRR3 [Zea mays] 53 6e-06 AQL07516.1 Two-component response regulator-like APRR3 [Zea mays] 53 7e-06 AQL07508.1 Two-component response regulator-like APRR3 [Zea mays] 53 7e-06 ACG24234.1 two-component response regulator-like PRR73 [Zea mays] 53 8e-06 NP_001146641.1 PseuodARR-B transcription factor [Zea mays] XP_00... 53 8e-06 CDP04335.1 unnamed protein product [Coffea canephora] 53 8e-06 >AQL07507.1 Two-component response regulator-like APRR3 [Zea mays] Length = 299 Score = 53.1 bits (126), Expect = 6e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -3 Query: 327 VRYQSRQRLAEQRPRVRGQFVRQEDDKKQTTKAED 223 VRYQSR+RLAEQRPRVRGQFVRQ + + QT + + Sbjct: 264 VRYQSRKRLAEQRPRVRGQFVRQSEQEDQTAQGSE 298 >AQL07516.1 Two-component response regulator-like APRR3 [Zea mays] Length = 603 Score = 53.1 bits (126), Expect = 7e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -3 Query: 327 VRYQSRQRLAEQRPRVRGQFVRQEDDKKQTTKAED 223 VRYQSR+RLAEQRPRVRGQFVRQ + + QT + + Sbjct: 568 VRYQSRKRLAEQRPRVRGQFVRQSEQEDQTAQGSE 602 >AQL07508.1 Two-component response regulator-like APRR3 [Zea mays] Length = 629 Score = 53.1 bits (126), Expect = 7e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -3 Query: 327 VRYQSRQRLAEQRPRVRGQFVRQEDDKKQTTKAED 223 VRYQSR+RLAEQRPRVRGQFVRQ + + QT + + Sbjct: 594 VRYQSRKRLAEQRPRVRGQFVRQSEQEDQTAQGSE 628 >ACG24234.1 two-component response regulator-like PRR73 [Zea mays] Length = 765 Score = 53.1 bits (126), Expect = 8e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -3 Query: 327 VRYQSRQRLAEQRPRVRGQFVRQEDDKKQTTKAED 223 VRYQSR+RLAEQRPRVRGQFVRQ + + QT + + Sbjct: 730 VRYQSRKRLAEQRPRVRGQFVRQSEQEDQTAQGSE 764 >NP_001146641.1 PseuodARR-B transcription factor [Zea mays] XP_008658527.1 PREDICTED: pseuodARR-B transcription factor isoform X1 [Zea mays] ACL54450.1 unknown [Zea mays] ADX60165.1 PseuodARR-B transcription factor, partial [Zea mays] AQL07505.1 Two-component response regulator-like APRR3 [Zea mays] AQL07519.1 Two-component response regulator-like APRR3 [Zea mays] Length = 766 Score = 53.1 bits (126), Expect = 8e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -3 Query: 327 VRYQSRQRLAEQRPRVRGQFVRQEDDKKQTTKAED 223 VRYQSR+RLAEQRPRVRGQFVRQ + + QT + + Sbjct: 731 VRYQSRKRLAEQRPRVRGQFVRQSEQEDQTAQGSE 765 >CDP04335.1 unnamed protein product [Coffea canephora] Length = 794 Score = 53.1 bits (126), Expect = 8e-06 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 1/39 (2%) Frame = -3 Query: 327 VRYQSRQRLAEQRPRVRGQFVRQE-DDKKQTTKAEDADS 214 VRYQSR++LAEQRPRVRGQFVRQ DD K + +D DS Sbjct: 756 VRYQSRKKLAEQRPRVRGQFVRQTVDDNKSKDRDKDPDS 794