BLASTX nr result
ID: Lithospermum23_contig00015915
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00015915 (366 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZV32345.1 hypothetical protein F511_22602 [Dorcoceras hygrometr... 54 5e-06 XP_010066869.1 PREDICTED: uncharacterized protein LOC104453914 [... 54 6e-06 >KZV32345.1 hypothetical protein F511_22602 [Dorcoceras hygrometricum] Length = 954 Score = 54.3 bits (129), Expect = 5e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = +1 Query: 1 VEKRSLTSWGKTTRRPRRQRCPVVNAPTVAST 96 +E RSLT WGKTTRRPRRQRCP PT+AST Sbjct: 923 LEDRSLTGWGKTTRRPRRQRCPAGIPPTIAST 954 >XP_010066869.1 PREDICTED: uncharacterized protein LOC104453914 [Eucalyptus grandis] KCW64909.1 hypothetical protein EUGRSUZ_G02465 [Eucalyptus grandis] Length = 1039 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +1 Query: 1 VEKRSLTSWGKTTRRPRRQRCPVVNAPTVAST 96 +E+RSLT WGKTTRRPRRQRCP N P++A T Sbjct: 1008 LEERSLTGWGKTTRRPRRQRCPAGNPPSLALT 1039