BLASTX nr result
ID: Lithospermum23_contig00014607
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00014607 (419 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012848542.1 PREDICTED: pre-mRNA-splicing factor CWC22-like [E... 59 1e-07 >XP_012848542.1 PREDICTED: pre-mRNA-splicing factor CWC22-like [Erythranthe guttata] EYU27952.1 hypothetical protein MIMGU_mgv1a023911mg [Erythranthe guttata] Length = 281 Score = 58.9 bits (141), Expect = 1e-07 Identities = 34/63 (53%), Positives = 42/63 (66%), Gaps = 1/63 (1%) Frame = +3 Query: 192 MGCCLST-KNTEPESTKPHLNKPNSSSFLAKDNSNSTLLPPSCPLVEEETIVKEVLSETP 368 MGCC ST K+T P T PH + ++ AK +S S PP+ PL+EEET VKEVLSETP Sbjct: 1 MGCCASTPKSTRPTKTPPHHIANSKTTTTAKRSSISKSPPPTHPLLEEET-VKEVLSETP 59 Query: 369 SLP 377 + P Sbjct: 60 AAP 62