BLASTX nr result
ID: Lithospermum23_contig00014417
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00014417 (362 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZV28935.1 hypothetical protein F511_13730 [Dorcoceras hygrometr... 59 1e-07 CDP01157.1 unnamed protein product [Coffea canephora] 55 2e-06 XP_019258745.1 PREDICTED: exocyst complex component SEC6 isoform... 54 8e-06 XP_016504676.1 PREDICTED: exocyst complex component SEC6 isoform... 54 8e-06 XP_009781052.1 PREDICTED: exocyst complex component SEC6 isoform... 54 8e-06 XP_018446850.1 PREDICTED: exocyst complex component SEC6-like is... 54 8e-06 XP_019258744.1 PREDICTED: exocyst complex component SEC6 isoform... 54 8e-06 XP_016504674.1 PREDICTED: exocyst complex component SEC6 isoform... 54 8e-06 XP_009781050.1 PREDICTED: exocyst complex component SEC6 isoform... 54 8e-06 XP_013728594.1 PREDICTED: exocyst complex component SEC6-like [B... 54 8e-06 XP_013591356.1 PREDICTED: exocyst complex component SEC6-like [B... 54 8e-06 XP_009104892.1 PREDICTED: exocyst complex component SEC6-like [B... 54 8e-06 CDX68300.1 BnaA07g23400D [Brassica napus] 54 8e-06 XP_018446849.1 PREDICTED: exocyst complex component SEC6-like is... 54 8e-06 XP_017248021.1 PREDICTED: exocyst complex component SEC6 [Daucus... 54 8e-06 CDY36681.1 BnaCnng07830D [Brassica napus] 54 8e-06 OIT40319.1 exocyst complex component sec6 [Nicotiana attenuata] 54 8e-06 >KZV28935.1 hypothetical protein F511_13730 [Dorcoceras hygrometricum] Length = 756 Score = 58.5 bits (140), Expect = 1e-07 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +3 Query: 3 VDGNPPKSGFLFPRVKCLNVAKTSLWRR 86 VDGNPPK GF+FPRVKCLN AKTSLWR+ Sbjct: 727 VDGNPPKGGFVFPRVKCLNAAKTSLWRK 754 >CDP01157.1 unnamed protein product [Coffea canephora] Length = 753 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/28 (78%), Positives = 27/28 (96%) Frame = +3 Query: 3 VDGNPPKSGFLFPRVKCLNVAKTSLWRR 86 VDGNPPK+GF+FPRVKCL+V+K SLWR+ Sbjct: 724 VDGNPPKAGFVFPRVKCLSVSKVSLWRK 751 >XP_019258745.1 PREDICTED: exocyst complex component SEC6 isoform X2 [Nicotiana attenuata] Length = 716 Score = 53.5 bits (127), Expect = 8e-06 Identities = 21/28 (75%), Positives = 26/28 (92%) Frame = +3 Query: 3 VDGNPPKSGFLFPRVKCLNVAKTSLWRR 86 VDGNPPK+GF+FPRVKCL+ AK S+WR+ Sbjct: 687 VDGNPPKTGFVFPRVKCLSAAKHSIWRK 714 >XP_016504676.1 PREDICTED: exocyst complex component SEC6 isoform X2 [Nicotiana tabacum] Length = 716 Score = 53.5 bits (127), Expect = 8e-06 Identities = 21/28 (75%), Positives = 26/28 (92%) Frame = +3 Query: 3 VDGNPPKSGFLFPRVKCLNVAKTSLWRR 86 VDGNPPK+GF+FPRVKCL+ AK S+WR+ Sbjct: 687 VDGNPPKTGFVFPRVKCLSAAKHSIWRK 714 >XP_009781052.1 PREDICTED: exocyst complex component SEC6 isoform X2 [Nicotiana sylvestris] Length = 716 Score = 53.5 bits (127), Expect = 8e-06 Identities = 21/28 (75%), Positives = 26/28 (92%) Frame = +3 Query: 3 VDGNPPKSGFLFPRVKCLNVAKTSLWRR 86 VDGNPPK+GF+FPRVKCL+ AK S+WR+ Sbjct: 687 VDGNPPKTGFVFPRVKCLSAAKHSIWRK 714 >XP_018446850.1 PREDICTED: exocyst complex component SEC6-like isoform X2 [Raphanus sativus] Length = 740 Score = 53.5 bits (127), Expect = 8e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = +3 Query: 3 VDGNPPKSGFLFPRVKCLNVAKTSLWRRKL 92 VDGNPPK+GF+FPRVKCL +K SLWR+++ Sbjct: 711 VDGNPPKTGFVFPRVKCLAASKGSLWRKRI 740 >XP_019258744.1 PREDICTED: exocyst complex component SEC6 isoform X1 [Nicotiana attenuata] Length = 749 Score = 53.5 bits (127), Expect = 8e-06 Identities = 21/28 (75%), Positives = 26/28 (92%) Frame = +3 Query: 3 VDGNPPKSGFLFPRVKCLNVAKTSLWRR 86 VDGNPPK+GF+FPRVKCL+ AK S+WR+ Sbjct: 720 VDGNPPKTGFVFPRVKCLSAAKHSIWRK 747 >XP_016504674.1 PREDICTED: exocyst complex component SEC6 isoform X1 [Nicotiana tabacum] XP_016504675.1 PREDICTED: exocyst complex component SEC6 isoform X1 [Nicotiana tabacum] Length = 749 Score = 53.5 bits (127), Expect = 8e-06 Identities = 21/28 (75%), Positives = 26/28 (92%) Frame = +3 Query: 3 VDGNPPKSGFLFPRVKCLNVAKTSLWRR 86 VDGNPPK+GF+FPRVKCL+ AK S+WR+ Sbjct: 720 VDGNPPKTGFVFPRVKCLSAAKHSIWRK 747 >XP_009781050.1 PREDICTED: exocyst complex component SEC6 isoform X1 [Nicotiana sylvestris] XP_009781051.1 PREDICTED: exocyst complex component SEC6 isoform X1 [Nicotiana sylvestris] Length = 749 Score = 53.5 bits (127), Expect = 8e-06 Identities = 21/28 (75%), Positives = 26/28 (92%) Frame = +3 Query: 3 VDGNPPKSGFLFPRVKCLNVAKTSLWRR 86 VDGNPPK+GF+FPRVKCL+ AK S+WR+ Sbjct: 720 VDGNPPKTGFVFPRVKCLSAAKHSIWRK 747 >XP_013728594.1 PREDICTED: exocyst complex component SEC6-like [Brassica napus] Length = 751 Score = 53.5 bits (127), Expect = 8e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = +3 Query: 3 VDGNPPKSGFLFPRVKCLNVAKTSLWRRKL 92 VDGNPPK+GF+FPRVKCL +K SLWR+++ Sbjct: 722 VDGNPPKTGFVFPRVKCLAASKGSLWRKRI 751 >XP_013591356.1 PREDICTED: exocyst complex component SEC6-like [Brassica oleracea var. oleracea] Length = 752 Score = 53.5 bits (127), Expect = 8e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = +3 Query: 3 VDGNPPKSGFLFPRVKCLNVAKTSLWRRKL 92 VDGNPPK+GF+FPRVKCL +K SLWR+++ Sbjct: 723 VDGNPPKTGFVFPRVKCLAASKGSLWRKRI 752 >XP_009104892.1 PREDICTED: exocyst complex component SEC6-like [Brassica rapa] Length = 752 Score = 53.5 bits (127), Expect = 8e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = +3 Query: 3 VDGNPPKSGFLFPRVKCLNVAKTSLWRRKL 92 VDGNPPK+GF+FPRVKCL +K SLWR+++ Sbjct: 723 VDGNPPKTGFVFPRVKCLAASKGSLWRKRI 752 >CDX68300.1 BnaA07g23400D [Brassica napus] Length = 752 Score = 53.5 bits (127), Expect = 8e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = +3 Query: 3 VDGNPPKSGFLFPRVKCLNVAKTSLWRRKL 92 VDGNPPK+GF+FPRVKCL +K SLWR+++ Sbjct: 723 VDGNPPKTGFVFPRVKCLAASKGSLWRKRI 752 >XP_018446849.1 PREDICTED: exocyst complex component SEC6-like isoform X1 [Raphanus sativus] Length = 753 Score = 53.5 bits (127), Expect = 8e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = +3 Query: 3 VDGNPPKSGFLFPRVKCLNVAKTSLWRRKL 92 VDGNPPK+GF+FPRVKCL +K SLWR+++ Sbjct: 724 VDGNPPKTGFVFPRVKCLAASKGSLWRKRI 753 >XP_017248021.1 PREDICTED: exocyst complex component SEC6 [Daucus carota subsp. sativus] Length = 756 Score = 53.5 bits (127), Expect = 8e-06 Identities = 21/27 (77%), Positives = 26/27 (96%) Frame = +3 Query: 3 VDGNPPKSGFLFPRVKCLNVAKTSLWR 83 VDGNPPK+GF+FP+VKCL+V+K SLWR Sbjct: 726 VDGNPPKAGFVFPKVKCLSVSKVSLWR 752 >CDY36681.1 BnaCnng07830D [Brassica napus] Length = 776 Score = 53.5 bits (127), Expect = 8e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = +3 Query: 3 VDGNPPKSGFLFPRVKCLNVAKTSLWRRKL 92 VDGNPPK+GF+FPRVKCL +K SLWR+++ Sbjct: 747 VDGNPPKTGFVFPRVKCLAASKGSLWRKRI 776 >OIT40319.1 exocyst complex component sec6 [Nicotiana attenuata] Length = 1287 Score = 53.5 bits (127), Expect = 8e-06 Identities = 21/28 (75%), Positives = 26/28 (92%) Frame = +3 Query: 3 VDGNPPKSGFLFPRVKCLNVAKTSLWRR 86 VDGNPPK+GF+FPRVKCL+ AK S+WR+ Sbjct: 1258 VDGNPPKTGFVFPRVKCLSAAKHSIWRK 1285