BLASTX nr result
ID: Lithospermum23_contig00014351
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00014351 (1017 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ONI33713.1 hypothetical protein PRUPE_1G442800 [Prunus persica] 69 3e-11 >ONI33713.1 hypothetical protein PRUPE_1G442800 [Prunus persica] Length = 70 Score = 68.6 bits (166), Expect = 3e-11 Identities = 34/58 (58%), Positives = 40/58 (68%) Frame = +2 Query: 842 KDAYSIWMLGCHDLHMSKVPISNWLALKMQIWIMPFTSGQHCLGVAIDNSYALLSAKE 1015 + YSI GCHDL + KVPISNWLALKMQIW++ F GQHCL N Y+L S +E Sbjct: 5 RSIYSIKDAGCHDLFVLKVPISNWLALKMQIWLLHFPWGQHCL----YNHYSLSSTEE 58