BLASTX nr result
ID: Lithospermum23_contig00014002
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00014002 (232 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDX86999.1 BnaC03g52690D [Brassica napus] 59 1e-09 KHG13717.1 40S ribosomal S11 [Gossypium arboreum] 59 2e-09 XP_016703020.1 PREDICTED: 40S ribosomal protein S11-like [Gossyp... 59 2e-09 XP_017624162.1 PREDICTED: 40S ribosomal protein S11 [Gossypium a... 59 3e-09 XP_017424106.1 PREDICTED: 40S ribosomal protein S11 [Vigna angul... 59 3e-09 XP_014499812.1 PREDICTED: 40S ribosomal protein S11 [Vigna radia... 59 3e-09 KNA17207.1 hypothetical protein SOVF_082140 [Spinacia oleracea] ... 59 3e-09 KNA09286.1 hypothetical protein SOVF_155040 [Spinacia oleracea] 59 3e-09 XP_012474397.1 PREDICTED: 40S ribosomal protein S11 [Gossypium r... 59 3e-09 XP_012473749.1 PREDICTED: 40S ribosomal protein S11 [Gossypium r... 59 3e-09 XP_011032811.1 PREDICTED: 40S ribosomal protein S11 [Populus eup... 59 3e-09 CDP18807.1 unnamed protein product [Coffea canephora] 59 3e-09 XP_008378412.1 PREDICTED: 40S ribosomal protein S11 [Malus domes... 59 3e-09 XP_008219543.1 PREDICTED: 40S ribosomal protein S11 [Prunus mume] 59 3e-09 XP_002526494.1 PREDICTED: 40S ribosomal protein S11 [Ricinus com... 59 3e-09 XP_002532505.1 PREDICTED: 40S ribosomal protein S11 [Ricinus com... 59 3e-09 XP_007159633.1 hypothetical protein PHAVU_002G254000g [Phaseolus... 59 3e-09 XP_007155106.1 hypothetical protein PHAVU_003G173800g [Phaseolus... 59 3e-09 XP_007146683.1 hypothetical protein PHAVU_006G060600g [Phaseolus... 59 3e-09 XP_007223638.1 hypothetical protein PRUPE_ppa012659mg [Prunus pe... 59 3e-09 >CDX86999.1 BnaC03g52690D [Brassica napus] Length = 89 Score = 58.9 bits (141), Expect = 1e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 142 IMAEQTEKAFLKQPKVFLSSKKTGKGNRPG 231 +MAEQTEKAFLKQPKVFLSSKK+GKG RPG Sbjct: 24 VMAEQTEKAFLKQPKVFLSSKKSGKGKRPG 53 >KHG13717.1 40S ribosomal S11 [Gossypium arboreum] Length = 126 Score = 59.3 bits (142), Expect = 2e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 145 MAEQTEKAFLKQPKVFLSSKKTGKGNRPG 231 MAEQTEKAFLKQPKVFLSSKKTGKG RPG Sbjct: 1 MAEQTEKAFLKQPKVFLSSKKTGKGKRPG 29 >XP_016703020.1 PREDICTED: 40S ribosomal protein S11-like [Gossypium hirsutum] Length = 145 Score = 59.3 bits (142), Expect = 2e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 145 MAEQTEKAFLKQPKVFLSSKKTGKGNRPG 231 MAEQTEKAFLKQPKVFLSSKKTGKG RPG Sbjct: 1 MAEQTEKAFLKQPKVFLSSKKTGKGKRPG 29 >XP_017624162.1 PREDICTED: 40S ribosomal protein S11 [Gossypium arboreum] Length = 159 Score = 59.3 bits (142), Expect = 3e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 145 MAEQTEKAFLKQPKVFLSSKKTGKGNRPG 231 MAEQTEKAFLKQPKVFLSSKKTGKG RPG Sbjct: 1 MAEQTEKAFLKQPKVFLSSKKTGKGKRPG 29 >XP_017424106.1 PREDICTED: 40S ribosomal protein S11 [Vigna angularis] BAT92744.1 hypothetical protein VIGAN_07156400 [Vigna angularis var. angularis] Length = 159 Score = 59.3 bits (142), Expect = 3e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 145 MAEQTEKAFLKQPKVFLSSKKTGKGNRPG 231 MAEQTEKAFLKQPKVFLSSKKTGKG RPG Sbjct: 1 MAEQTEKAFLKQPKVFLSSKKTGKGKRPG 29 >XP_014499812.1 PREDICTED: 40S ribosomal protein S11 [Vigna radiata var. radiata] Length = 159 Score = 59.3 bits (142), Expect = 3e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 145 MAEQTEKAFLKQPKVFLSSKKTGKGNRPG 231 MAEQTEKAFLKQPKVFLSSKKTGKG RPG Sbjct: 1 MAEQTEKAFLKQPKVFLSSKKTGKGKRPG 29 >KNA17207.1 hypothetical protein SOVF_082140 [Spinacia oleracea] KNA20682.1 hypothetical protein SOVF_049780 [Spinacia oleracea] Length = 159 Score = 59.3 bits (142), Expect = 3e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 145 MAEQTEKAFLKQPKVFLSSKKTGKGNRPG 231 MAEQTEKAFLKQPKVFLSSKKTGKG RPG Sbjct: 1 MAEQTEKAFLKQPKVFLSSKKTGKGKRPG 29 >KNA09286.1 hypothetical protein SOVF_155040 [Spinacia oleracea] Length = 159 Score = 59.3 bits (142), Expect = 3e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 145 MAEQTEKAFLKQPKVFLSSKKTGKGNRPG 231 MAEQTEKAFLKQPKVFLSSKKTGKG RPG Sbjct: 1 MAEQTEKAFLKQPKVFLSSKKTGKGKRPG 29 >XP_012474397.1 PREDICTED: 40S ribosomal protein S11 [Gossypium raimondii] KJB23700.1 hypothetical protein B456_004G110600 [Gossypium raimondii] Length = 159 Score = 59.3 bits (142), Expect = 3e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 145 MAEQTEKAFLKQPKVFLSSKKTGKGNRPG 231 MAEQTEKAFLKQPKVFLSSKKTGKG RPG Sbjct: 1 MAEQTEKAFLKQPKVFLSSKKTGKGKRPG 29 >XP_012473749.1 PREDICTED: 40S ribosomal protein S11 [Gossypium raimondii] KJB22832.1 hypothetical protein B456_004G068000 [Gossypium raimondii] Length = 159 Score = 59.3 bits (142), Expect = 3e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 145 MAEQTEKAFLKQPKVFLSSKKTGKGNRPG 231 MAEQTEKAFLKQPKVFLSSKKTGKG RPG Sbjct: 1 MAEQTEKAFLKQPKVFLSSKKTGKGKRPG 29 >XP_011032811.1 PREDICTED: 40S ribosomal protein S11 [Populus euphratica] Length = 159 Score = 59.3 bits (142), Expect = 3e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 145 MAEQTEKAFLKQPKVFLSSKKTGKGNRPG 231 MAEQTEKAFLKQPKVFLSSKKTGKG RPG Sbjct: 1 MAEQTEKAFLKQPKVFLSSKKTGKGKRPG 29 >CDP18807.1 unnamed protein product [Coffea canephora] Length = 159 Score = 59.3 bits (142), Expect = 3e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 145 MAEQTEKAFLKQPKVFLSSKKTGKGNRPG 231 MAEQTEKAFLKQPKVFLSSKKTGKG RPG Sbjct: 1 MAEQTEKAFLKQPKVFLSSKKTGKGKRPG 29 >XP_008378412.1 PREDICTED: 40S ribosomal protein S11 [Malus domestica] XP_008394149.1 PREDICTED: 40S ribosomal protein S11 [Malus domestica] Length = 159 Score = 59.3 bits (142), Expect = 3e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 145 MAEQTEKAFLKQPKVFLSSKKTGKGNRPG 231 MAEQTEKAFLKQPKVFLSSKKTGKG RPG Sbjct: 1 MAEQTEKAFLKQPKVFLSSKKTGKGKRPG 29 >XP_008219543.1 PREDICTED: 40S ribosomal protein S11 [Prunus mume] Length = 159 Score = 59.3 bits (142), Expect = 3e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 145 MAEQTEKAFLKQPKVFLSSKKTGKGNRPG 231 MAEQTEKAFLKQPKVFLSSKKTGKG RPG Sbjct: 1 MAEQTEKAFLKQPKVFLSSKKTGKGKRPG 29 >XP_002526494.1 PREDICTED: 40S ribosomal protein S11 [Ricinus communis] EEF35885.1 40S ribosomal protein S11, putative [Ricinus communis] Length = 159 Score = 59.3 bits (142), Expect = 3e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 145 MAEQTEKAFLKQPKVFLSSKKTGKGNRPG 231 MAEQTEKAFLKQPKVFLSSKKTGKG RPG Sbjct: 1 MAEQTEKAFLKQPKVFLSSKKTGKGKRPG 29 >XP_002532505.1 PREDICTED: 40S ribosomal protein S11 [Ricinus communis] EEF29881.1 40S ribosomal protein S11, putative [Ricinus communis] Length = 159 Score = 59.3 bits (142), Expect = 3e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 145 MAEQTEKAFLKQPKVFLSSKKTGKGNRPG 231 MAEQTEKAFLKQPKVFLSSKKTGKG RPG Sbjct: 1 MAEQTEKAFLKQPKVFLSSKKTGKGKRPG 29 >XP_007159633.1 hypothetical protein PHAVU_002G254000g [Phaseolus vulgaris] ESW31627.1 hypothetical protein PHAVU_002G254000g [Phaseolus vulgaris] Length = 159 Score = 59.3 bits (142), Expect = 3e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 145 MAEQTEKAFLKQPKVFLSSKKTGKGNRPG 231 MAEQTEKAFLKQPKVFLSSKKTGKG RPG Sbjct: 1 MAEQTEKAFLKQPKVFLSSKKTGKGKRPG 29 >XP_007155106.1 hypothetical protein PHAVU_003G173800g [Phaseolus vulgaris] XP_007155107.1 hypothetical protein PHAVU_003G173900g [Phaseolus vulgaris] ESW27100.1 hypothetical protein PHAVU_003G173800g [Phaseolus vulgaris] ESW27101.1 hypothetical protein PHAVU_003G173900g [Phaseolus vulgaris] Length = 159 Score = 59.3 bits (142), Expect = 3e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 145 MAEQTEKAFLKQPKVFLSSKKTGKGNRPG 231 MAEQTEKAFLKQPKVFLSSKKTGKG RPG Sbjct: 1 MAEQTEKAFLKQPKVFLSSKKTGKGKRPG 29 >XP_007146683.1 hypothetical protein PHAVU_006G060600g [Phaseolus vulgaris] ESW18677.1 hypothetical protein PHAVU_006G060600g [Phaseolus vulgaris] Length = 159 Score = 59.3 bits (142), Expect = 3e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 145 MAEQTEKAFLKQPKVFLSSKKTGKGNRPG 231 MAEQTEKAFLKQPKVFLSSKKTGKG RPG Sbjct: 1 MAEQTEKAFLKQPKVFLSSKKTGKGKRPG 29 >XP_007223638.1 hypothetical protein PRUPE_ppa012659mg [Prunus persica] ONI34511.1 hypothetical protein PRUPE_1G485300 [Prunus persica] Length = 159 Score = 59.3 bits (142), Expect = 3e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 145 MAEQTEKAFLKQPKVFLSSKKTGKGNRPG 231 MAEQTEKAFLKQPKVFLSSKKTGKG RPG Sbjct: 1 MAEQTEKAFLKQPKVFLSSKKTGKGKRPG 29