BLASTX nr result
ID: Lithospermum23_contig00013777
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00013777 (822 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011090243.1 PREDICTED: uncharacterized protein LOC105170968 [... 58 7e-06 CDP06875.1 unnamed protein product [Coffea canephora] 58 7e-06 >XP_011090243.1 PREDICTED: uncharacterized protein LOC105170968 [Sesamum indicum] Length = 648 Score = 57.8 bits (138), Expect = 7e-06 Identities = 31/69 (44%), Positives = 47/69 (68%), Gaps = 2/69 (2%) Frame = +1 Query: 250 KVISQDVINPELAYSETP--SRTIYHLLLGLHEIFVDVLSTGGALVHAQKMLSNIENGKI 423 K+ S+DV+ P + Y E P ++ +Y LL+ LH+IF D+ S G AL AQKML ++ G+ Sbjct: 267 KIASEDVVRPLVDY-EVPQFAKCVYPLLVDLHDIFADIPSMGTALACAQKMLCDVNKGEN 325 Query: 424 LNSRLFSEV 450 +++RL SEV Sbjct: 326 VDTRLLSEV 334 >CDP06875.1 unnamed protein product [Coffea canephora] Length = 651 Score = 57.8 bits (138), Expect = 7e-06 Identities = 36/72 (50%), Positives = 49/72 (68%), Gaps = 2/72 (2%) Frame = +1 Query: 241 SGMKVISQDVINPELAYSETP--SRTIYHLLLGLHEIFVDVLSTGGALVHAQKMLSNIEN 414 S +K+ S+DV P + Y E P S++IY LL+ LH+IFVD+ G AL HAQKMLS I Sbjct: 267 SVLKMGSEDV-QPRVDY-EAPQFSQSIYPLLVDLHDIFVDIPYMGRALAHAQKMLSAINK 324 Query: 415 GKILNSRLFSEV 450 G+ ++ +L SEV Sbjct: 325 GEAVDGQLLSEV 336