BLASTX nr result
ID: Lithospermum23_contig00013450
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00013450 (485 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019189178.1 PREDICTED: probable LRR receptor-like serine/thre... 55 8e-06 >XP_019189178.1 PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g12460 [Ipomoea nil] Length = 882 Score = 55.1 bits (131), Expect = 8e-06 Identities = 23/38 (60%), Positives = 30/38 (78%) Frame = -3 Query: 114 MRRLGTFFHCIVLFWSVWLLEFMIVSQVTEKEILLLFK 1 M+R+GT+ +C+VLFW WL EF +V +TEKEILL FK Sbjct: 1 MKRIGTYAYCLVLFWCFWLSEFHLVFTITEKEILLQFK 38