BLASTX nr result
ID: Lithospermum23_contig00013438
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00013438 (297 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007215057.1 hypothetical protein PRUPE_ppa012217mg [Prunus pe... 52 8e-06 >XP_007215057.1 hypothetical protein PRUPE_ppa012217mg [Prunus persica] XP_008229093.1 PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Prunus mume] ONI16734.1 hypothetical protein PRUPE_3G118100 [Prunus persica] ONI16735.1 hypothetical protein PRUPE_3G118100 [Prunus persica] Length = 179 Score = 51.6 bits (122), Expect = 8e-06 Identities = 24/46 (52%), Positives = 30/46 (65%) Frame = +3 Query: 159 MSSDRGRDFTPDQGYFSSINSSEGGESHQSSTTPSRYESQKRRDWN 296 MS++RG+DF S ++ G+ HQ TPSRYESQKRRDWN Sbjct: 1 MSAERGKDFAD-----GSSSAGSPGDDHQQPATPSRYESQKRRDWN 41