BLASTX nr result
ID: Lithospermum23_contig00013291
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00013291 (635 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU35323.1 hypothetical protein TSUD_337150 [Trifolium subterran... 67 2e-11 >GAU35323.1 hypothetical protein TSUD_337150 [Trifolium subterraneum] Length = 91 Score = 67.4 bits (163), Expect = 2e-11 Identities = 36/73 (49%), Positives = 49/73 (67%) Frame = -1 Query: 506 KCWQQC*SWRIQSWVDCLNCYWRASIDIPCWQLCALRLCT*NPSSEKEEANLQKEDEEGK 327 KCW R+ S + C W +IDIP W+L ALRLCT + S+K+EA+L+KEDE+G+ Sbjct: 21 KCWISRVQPRLNSSLGC----WWVAIDIPRWKLRALRLCTEDHRSKKKEASLKKEDEKGE 76 Query: 326 TEARCCSSRRIVL 288 TEAR +RR+ L Sbjct: 77 TEARRLHTRRVEL 89