BLASTX nr result
ID: Lithospermum23_contig00013187
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00013187 (309 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018822075.1 PREDICTED: uncharacterized protein LOC108992053 [... 61 9e-09 KZV24849.1 hypothetical protein F511_14732 [Dorcoceras hygrometr... 60 2e-08 XP_016190366.1 PREDICTED: uncharacterized protein LOC107631433 [... 60 2e-08 XP_002279421.2 PREDICTED: uncharacterized protein LOC100244084 [... 59 3e-08 XP_012079885.1 PREDICTED: uncharacterized protein LOC105640232 [... 59 3e-08 XP_006476990.1 PREDICTED: uncharacterized protein LOC102626101 [... 59 4e-08 XP_006440059.1 hypothetical protein CICLE_v10021486mg [Citrus cl... 59 4e-08 XP_019240586.1 PREDICTED: uncharacterized protein LOC109220578 [... 59 5e-08 XP_003608867.1 hypothetical protein MTR_4g103840 [Medicago trunc... 58 7e-08 OMO97825.1 hypothetical protein COLO4_14335 [Corchorus olitorius] 58 8e-08 OMO95069.1 hypothetical protein CCACVL1_05610 [Corchorus capsula... 58 8e-08 OAY30725.1 hypothetical protein MANES_14G054200 [Manihot esculen... 58 1e-07 XP_016484296.1 PREDICTED: uncharacterized protein LOC107804873 [... 58 1e-07 XP_016469122.1 PREDICTED: uncharacterized protein LOC107791551 [... 58 1e-07 XP_009758931.1 PREDICTED: uncharacterized protein LOC104211555 [... 58 1e-07 JAU13354.1 hypothetical protein GA_TR18758_c0_g1_i1_g.60325, par... 55 1e-07 XP_008239623.1 PREDICTED: uncharacterized protein LOC103338217 [... 57 1e-07 XP_007211014.1 hypothetical protein PRUPE_ppa020510mg [Prunus pe... 57 2e-07 XP_015068451.1 PREDICTED: uncharacterized protein LOC107012985 [... 57 2e-07 XP_006351488.1 PREDICTED: uncharacterized protein LOC102590433 [... 57 2e-07 >XP_018822075.1 PREDICTED: uncharacterized protein LOC108992053 [Juglans regia] Length = 307 Score = 60.8 bits (146), Expect = 9e-09 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = +1 Query: 1 SSFTLPCDVWRMDFGGFAWRLDTKAALSLSR 93 SS TLPCDVWRMD GGFAWRLD KAALSL R Sbjct: 277 SSLTLPCDVWRMDSGGFAWRLDVKAALSLGR 307 >KZV24849.1 hypothetical protein F511_14732 [Dorcoceras hygrometricum] Length = 294 Score = 60.1 bits (144), Expect = 2e-08 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 1 SSFTLPCDVWRMDFGGFAWRLDTKAALSL 87 SS TLPCDVWRMD GGFAWRLDTKAALSL Sbjct: 264 SSSTLPCDVWRMDCGGFAWRLDTKAALSL 292 >XP_016190366.1 PREDICTED: uncharacterized protein LOC107631433 [Arachis ipaensis] Length = 295 Score = 59.7 bits (143), Expect = 2e-08 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 1 SSFTLPCDVWRMDFGGFAWRLDTKAALSL 87 S+ T+PCDVWRMDFGGFAWRLD KAALSL Sbjct: 263 SALTVPCDVWRMDFGGFAWRLDVKAALSL 291 >XP_002279421.2 PREDICTED: uncharacterized protein LOC100244084 [Vitis vinifera] Length = 291 Score = 59.3 bits (142), Expect = 3e-08 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +1 Query: 1 SSFTLPCDVWRMDFGGFAWRLDTKAALSLSR 93 +S TLPCDVWRMD GGFAWRLD KAALSL R Sbjct: 261 NSLTLPCDVWRMDGGGFAWRLDVKAALSLGR 291 >XP_012079885.1 PREDICTED: uncharacterized protein LOC105640232 [Jatropha curcas] Length = 303 Score = 59.3 bits (142), Expect = 3e-08 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +1 Query: 1 SSFTLPCDVWRMDFGGFAWRLDTKAALSLSR 93 SS T+PCDVWRMD GGFAWRLD KAALSL R Sbjct: 273 SSITVPCDVWRMDRGGFAWRLDVKAALSLGR 303 >XP_006476990.1 PREDICTED: uncharacterized protein LOC102626101 [Citrus sinensis] Length = 288 Score = 58.9 bits (141), Expect = 4e-08 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +1 Query: 1 SSFTLPCDVWRMDFGGFAWRLDTKAALSLSR 93 +S TLPCDVWRMD GGFAWRLD KAALSL R Sbjct: 258 NSLTLPCDVWRMDGGGFAWRLDLKAALSLGR 288 >XP_006440059.1 hypothetical protein CICLE_v10021486mg [Citrus clementina] ESR53299.1 hypothetical protein CICLE_v10021486mg [Citrus clementina] KDO52575.1 hypothetical protein CISIN_1g044567mg [Citrus sinensis] Length = 288 Score = 58.9 bits (141), Expect = 4e-08 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +1 Query: 1 SSFTLPCDVWRMDFGGFAWRLDTKAALSLSR 93 +S TLPCDVWRMD GGFAWRLD KAALSL R Sbjct: 258 NSLTLPCDVWRMDGGGFAWRLDLKAALSLGR 288 >XP_019240586.1 PREDICTED: uncharacterized protein LOC109220578 [Nicotiana attenuata] OIT20137.1 hypothetical protein A4A49_38961 [Nicotiana attenuata] Length = 318 Score = 58.9 bits (141), Expect = 5e-08 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +1 Query: 1 SSFTLPCDVWRMDFGGFAWRLDTKAALSLSR 93 +S LPCDVWRMD GGFAWRLDTKAALSL R Sbjct: 288 NSLILPCDVWRMDNGGFAWRLDTKAALSLGR 318 >XP_003608867.1 hypothetical protein MTR_4g103840 [Medicago truncatula] AES91064.1 hypothetical protein MTR_4g103840 [Medicago truncatula] Length = 266 Score = 58.2 bits (139), Expect = 7e-08 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +1 Query: 7 FTLPCDVWRMDFGGFAWRLDTKAALSL 87 FTLPCDVWRMD GGFAWRLD KAALSL Sbjct: 236 FTLPCDVWRMDCGGFAWRLDVKAALSL 262 >OMO97825.1 hypothetical protein COLO4_14335 [Corchorus olitorius] Length = 283 Score = 58.2 bits (139), Expect = 8e-08 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = +1 Query: 1 SSFTLPCDVWRMDFGGFAWRLDTKAALSLSR 93 SS TLPCDVWRMD GGFAWRLD AALSL R Sbjct: 253 SSLTLPCDVWRMDGGGFAWRLDINAALSLGR 283 >OMO95069.1 hypothetical protein CCACVL1_05610 [Corchorus capsularis] Length = 283 Score = 58.2 bits (139), Expect = 8e-08 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = +1 Query: 1 SSFTLPCDVWRMDFGGFAWRLDTKAALSLSR 93 SS TLPCDVWRMD GGFAWRLD AALSL R Sbjct: 253 SSLTLPCDVWRMDGGGFAWRLDINAALSLGR 283 >OAY30725.1 hypothetical protein MANES_14G054200 [Manihot esculenta] OAY30726.1 hypothetical protein MANES_14G054200 [Manihot esculenta] Length = 306 Score = 57.8 bits (138), Expect = 1e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 1 SSFTLPCDVWRMDFGGFAWRLDTKAALSLSR 93 SS T+PCDVWRM+ GGFAWRLD KAALSL R Sbjct: 276 SSITVPCDVWRMEGGGFAWRLDVKAALSLGR 306 >XP_016484296.1 PREDICTED: uncharacterized protein LOC107804873 [Nicotiana tabacum] XP_018628450.1 PREDICTED: uncharacterized protein LOC104102505 [Nicotiana tomentosiformis] Length = 317 Score = 57.8 bits (138), Expect = 1e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 1 SSFTLPCDVWRMDFGGFAWRLDTKAALSLSR 93 +S LPCDVWRMD GG+AWRLDTKAALSL R Sbjct: 287 NSLILPCDVWRMDGGGYAWRLDTKAALSLGR 317 >XP_016469122.1 PREDICTED: uncharacterized protein LOC107791551 [Nicotiana tabacum] Length = 323 Score = 57.8 bits (138), Expect = 1e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 1 SSFTLPCDVWRMDFGGFAWRLDTKAALSLSR 93 +S LPCDVWRMD GG+AWRLDTKAALSL R Sbjct: 293 NSLILPCDVWRMDGGGYAWRLDTKAALSLGR 323 >XP_009758931.1 PREDICTED: uncharacterized protein LOC104211555 [Nicotiana sylvestris] Length = 323 Score = 57.8 bits (138), Expect = 1e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 1 SSFTLPCDVWRMDFGGFAWRLDTKAALSLSR 93 +S LPCDVWRMD GG+AWRLDTKAALSL R Sbjct: 293 NSLILPCDVWRMDGGGYAWRLDTKAALSLGR 323 >JAU13354.1 hypothetical protein GA_TR18758_c0_g1_i1_g.60325, partial [Noccaea caerulescens] Length = 113 Score = 55.1 bits (131), Expect = 1e-07 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = +1 Query: 10 TLPCDVWRMDFGGFAWRLDTKAALSL 87 T+PCDVW+MDFGGFAWRLDT AAL+L Sbjct: 86 TVPCDVWKMDFGGFAWRLDTTAALTL 111 >XP_008239623.1 PREDICTED: uncharacterized protein LOC103338217 [Prunus mume] Length = 276 Score = 57.4 bits (137), Expect = 1e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +1 Query: 1 SSFTLPCDVWRMDFGGFAWRLDTKAALSLSR 93 SS TLPCDVWRM+ GGFAWRLD KAAL L R Sbjct: 246 SSLTLPCDVWRMESGGFAWRLDVKAALCLGR 276 >XP_007211014.1 hypothetical protein PRUPE_ppa020510mg [Prunus persica] ONI08039.1 hypothetical protein PRUPE_5G154700 [Prunus persica] Length = 303 Score = 57.4 bits (137), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +1 Query: 1 SSFTLPCDVWRMDFGGFAWRLDTKAALSLSR 93 SS TLPCDVWRM+ GGFAWRLD KAAL L R Sbjct: 273 SSLTLPCDVWRMESGGFAWRLDVKAALCLGR 303 >XP_015068451.1 PREDICTED: uncharacterized protein LOC107012985 [Solanum pennellii] Length = 309 Score = 57.4 bits (137), Expect = 2e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 1 SSFTLPCDVWRMDFGGFAWRLDTKAALSLSR 93 +S LPCDVWRMD GGFAWRLDT+AALSL R Sbjct: 279 NSLILPCDVWRMDGGGFAWRLDTEAALSLGR 309 >XP_006351488.1 PREDICTED: uncharacterized protein LOC102590433 [Solanum tuberosum] Length = 309 Score = 57.4 bits (137), Expect = 2e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 1 SSFTLPCDVWRMDFGGFAWRLDTKAALSLSR 93 +S LPCDVWRMD GGFAWRLDT+AALSL R Sbjct: 267 NSLILPCDVWRMDGGGFAWRLDTEAALSLGR 297