BLASTX nr result
ID: Lithospermum23_contig00012411
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00012411 (438 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016462027.1 PREDICTED: putative glycerol-3-phosphate transpor... 65 1e-09 XP_009626899.1 PREDICTED: putative glycerol-3-phosphate transpor... 65 1e-09 XP_009772121.1 PREDICTED: putative glycerol-3-phosphate transpor... 64 4e-09 XP_019263524.1 PREDICTED: putative glycerol-3-phosphate transpor... 62 1e-08 XP_015077952.1 PREDICTED: putative glycerol-3-phosphate transpor... 60 8e-08 XP_004242279.1 PREDICTED: putative glycerol-3-phosphate transpor... 59 2e-07 XP_009615838.1 PREDICTED: putative glycerol-3-phosphate transpor... 55 3e-06 >XP_016462027.1 PREDICTED: putative glycerol-3-phosphate transporter 4 [Nicotiana tabacum] Length = 539 Score = 65.5 bits (158), Expect = 1e-09 Identities = 32/53 (60%), Positives = 42/53 (79%) Frame = -3 Query: 436 AVFTMLIICELAAGLLLTRLVISEQAEKLSKRRHHGQHNAGDSPSAPLLAQQR 278 AVF ML++ L+AGLLL+RLV+SE +EK SKR +GQHN+G S S PLL+ Q+ Sbjct: 487 AVFIMLVVGALSAGLLLSRLVVSELSEKFSKRLPYGQHNSGGSASQPLLSDQK 539 >XP_009626899.1 PREDICTED: putative glycerol-3-phosphate transporter 4 [Nicotiana tomentosiformis] Length = 539 Score = 65.5 bits (158), Expect = 1e-09 Identities = 32/53 (60%), Positives = 42/53 (79%) Frame = -3 Query: 436 AVFTMLIICELAAGLLLTRLVISEQAEKLSKRRHHGQHNAGDSPSAPLLAQQR 278 AVF ML++ L+AGLLL+RLV+SE +EK SKR +GQHN+G S S PLL+ Q+ Sbjct: 487 AVFIMLVVGALSAGLLLSRLVVSELSEKFSKRLPYGQHNSGGSASQPLLSDQK 539 >XP_009772121.1 PREDICTED: putative glycerol-3-phosphate transporter 4 [Nicotiana sylvestris] XP_016494466.1 PREDICTED: putative glycerol-3-phosphate transporter 4 [Nicotiana tabacum] Length = 539 Score = 63.9 bits (154), Expect = 4e-09 Identities = 31/53 (58%), Positives = 42/53 (79%) Frame = -3 Query: 436 AVFTMLIICELAAGLLLTRLVISEQAEKLSKRRHHGQHNAGDSPSAPLLAQQR 278 AVF ML++ L+AGLLL+RLV+SE +EK SK+ +GQHN+G S S PLL+ Q+ Sbjct: 487 AVFIMLVVGALSAGLLLSRLVVSELSEKFSKQLPYGQHNSGGSASQPLLSDQK 539 >XP_019263524.1 PREDICTED: putative glycerol-3-phosphate transporter 4 [Nicotiana attenuata] OIT37085.1 putative glycerol-3-phosphate transporter 4 [Nicotiana attenuata] Length = 539 Score = 62.4 bits (150), Expect = 1e-08 Identities = 30/53 (56%), Positives = 41/53 (77%) Frame = -3 Query: 436 AVFTMLIICELAAGLLLTRLVISEQAEKLSKRRHHGQHNAGDSPSAPLLAQQR 278 AVF ML++ ++AGLLL+RLV+SE +EK SKR +GQHN+G S PLL+ Q+ Sbjct: 487 AVFIMLVVGAVSAGLLLSRLVVSELSEKFSKRLPYGQHNSGGCASQPLLSDQK 539 >XP_015077952.1 PREDICTED: putative glycerol-3-phosphate transporter 4 [Solanum pennellii] Length = 537 Score = 60.1 bits (144), Expect = 8e-08 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = -3 Query: 436 AVFTMLIICELAAGLLLTRLVISEQAEKLSKRRHHGQHNAGDSPSAPLLAQQR 278 AVF ML++ L+AGLLL+RLV+SE +EK SKR QHN+ DS S PLL ++R Sbjct: 485 AVFIMLVVGALSAGLLLSRLVLSELSEKFSKRLAFEQHNSEDSASQPLLRERR 537 >XP_004242279.1 PREDICTED: putative glycerol-3-phosphate transporter 4 [Solanum lycopersicum] Length = 537 Score = 59.3 bits (142), Expect = 2e-07 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = -3 Query: 436 AVFTMLIICELAAGLLLTRLVISEQAEKLSKRRHHGQHNAGDSPSAPLLAQQR 278 AVF ML++ L+AGLLL+RLV+SE +EK SKR QHN+ DS S PLL ++R Sbjct: 485 AVFIMLVVGALSAGLLLSRLVLSELSEKFSKRLACEQHNSEDSASQPLLRERR 537 >XP_009615838.1 PREDICTED: putative glycerol-3-phosphate transporter 4 [Nicotiana tomentosiformis] Length = 222 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -3 Query: 436 AVFTMLIICELAAGLLLTRLVISEQAEKLSKRRHHGQHNAG 314 AVF ML++ L+AGLLL+RLV+SE +EK SKR +GQHN+G Sbjct: 154 AVFIMLVVGALSAGLLLSRLVVSELSEKFSKRLPYGQHNSG 194