BLASTX nr result
ID: Lithospermum23_contig00012197
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00012197 (464 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIT28104.1 hypothetical protein A4A49_20662 [Nicotiana attenuata] 55 3e-07 >OIT28104.1 hypothetical protein A4A49_20662 [Nicotiana attenuata] Length = 73 Score = 54.7 bits (130), Expect = 3e-07 Identities = 30/57 (52%), Positives = 39/57 (68%), Gaps = 6/57 (10%) Frame = +3 Query: 96 MYSVGISYAHLSVQQKKQKEKLKRMEEERARKEG------KVIEDNKCCNKSNKIHP 248 M S+G++YAHL VQQK+ KEK KRMEEE+AR K++ED K +K KI+P Sbjct: 1 MASMGVNYAHLHVQQKRLKEKSKRMEEEKARSNNEGGAVKKLVEDGK-RSKGKKIYP 56