BLASTX nr result
ID: Lithospermum23_contig00012067
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00012067 (294 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013445449.1 LRR receptor-like kinase, putative [Medicago trun... 54 4e-06 >XP_013445449.1 LRR receptor-like kinase, putative [Medicago truncatula] KEH19475.1 LRR receptor-like kinase, putative [Medicago truncatula] Length = 1031 Score = 53.5 bits (127), Expect = 4e-06 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = -2 Query: 293 LSGDIEVTTVTSMPGYLAGWSSNEPSLIMSNVDSK-IDTSLFGSTAPTT 150 LSGDIEV TVTS PGYL W ++ S IM++V +K +DTS + STA T+ Sbjct: 957 LSGDIEVGTVTSRPGYLTDWKFDDVSSIMTDVSAKGLDTSNYNSTASTS 1005