BLASTX nr result
ID: Lithospermum23_contig00011787
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00011787 (725 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KCW55427.1 hypothetical protein EUGRSUZ_I01330 [Eucalyptus grandis] 59 1e-07 OMP05967.1 hypothetical protein COLO4_08423 [Corchorus olitorius] 58 5e-06 >KCW55427.1 hypothetical protein EUGRSUZ_I01330 [Eucalyptus grandis] Length = 121 Score = 58.9 bits (141), Expect = 1e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -2 Query: 481 ISLKGRGQGVDLGTSTLSLIRSMILSFFPLAFPYD 377 +SLKGRGQGVDLGTSTLSL+RS+ SFF AFPYD Sbjct: 1 MSLKGRGQGVDLGTSTLSLMRSIFFSFFGRAFPYD 35 >OMP05967.1 hypothetical protein COLO4_08423 [Corchorus olitorius] Length = 840 Score = 57.8 bits (138), Expect = 5e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -2 Query: 481 ISLKGRGQGVDLGTSTLSLIRSMILSFFPLAFPYD 377 +SLKGRGQGVDLGTST SLIRS+I SF L FPYD Sbjct: 1 MSLKGRGQGVDLGTSTSSLIRSIIFSFLGLVFPYD 35