BLASTX nr result
ID: Lithospermum23_contig00011665
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00011665 (521 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP06874.1 unnamed protein product [Coffea canephora] 78 3e-14 KVH91401.1 DNA-binding, integrase-type, partial [Cynara carduncu... 67 1e-10 XP_016546997.1 PREDICTED: methyl-CpG-binding domain-containing p... 66 6e-10 GAQ90283.1 hypothetical protein KFL_006220020 [Klebsormidium fla... 67 7e-10 XP_016483756.1 PREDICTED: methyl-CpG-binding domain-containing p... 66 7e-10 XP_009787915.1 PREDICTED: methyl-CpG-binding domain-containing p... 66 7e-10 XP_009604783.1 PREDICTED: methyl-CpG-binding domain-containing p... 66 7e-10 KZV17375.1 methyl-CpG-binding domain-containing protein 5 [Dorco... 65 1e-09 XP_015056606.1 PREDICTED: methyl-CpG-binding domain-containing p... 64 3e-09 ALO02507.1 MBD5 [Solanum lycopersicum] 64 3e-09 NP_001316316.1 methyl-CpG-binding domain-containing protein 5 [S... 64 3e-09 XP_006362862.1 PREDICTED: methyl-CpG-binding domain-containing p... 63 9e-09 XP_019164185.1 PREDICTED: methyl-CpG-binding domain-containing p... 62 1e-08 XP_010264451.1 PREDICTED: uncharacterized protein LOC104602459 i... 62 2e-08 XP_010264450.1 PREDICTED: uncharacterized protein LOC104602459 i... 62 2e-08 XP_012838519.1 PREDICTED: methyl-CpG-binding domain-containing p... 61 2e-08 XP_008223622.1 PREDICTED: methyl-CpG-binding domain-containing p... 61 3e-08 XP_011090325.1 PREDICTED: methyl-CpG-binding domain-containing p... 60 4e-08 EPS60413.1 hypothetical protein M569_14391, partial [Genlisea au... 59 5e-08 XP_006291907.1 hypothetical protein CARUB_v10018084mg [Capsella ... 60 6e-08 >CDP06874.1 unnamed protein product [Coffea canephora] Length = 254 Score = 77.8 bits (190), Expect = 3e-14 Identities = 51/140 (36%), Positives = 71/140 (50%), Gaps = 17/140 (12%) Frame = +3 Query: 147 KNKTEAISVMDPNI---QETRTDPFL------EFDRFVRDDVIQARRPGPEPEPV----- 284 +N + +++DP+I + DP L + D+ V D +P P Sbjct: 10 QNPVQGSNLVDPDIAFDDQILPDPLLGTGWLIDADQKVDDAASAEEKPAPAETSAKPSAT 69 Query: 285 -FVDGHVESPGGSVKKSKRLLEE--EHPSWLPEDWRQEFRMRTSGATAGTYDRYFFSPTG 455 +E S ++ +R +EE E P WLP+DW+ E R+RTSGATAGT DRYFFSP+G Sbjct: 70 PMASAAIEVTPLSQRRPRRPVEEMAERPDWLPDDWKIEVRVRTSGATAGTSDRYFFSPSG 129 Query: 456 KRFRSKPRYSIF**QDPRRK 515 +FRSK F RRK Sbjct: 130 LKFRSKVEVLEFLETGSRRK 149 >KVH91401.1 DNA-binding, integrase-type, partial [Cynara cardunculus var. scolymus] Length = 249 Score = 67.4 bits (163), Expect(2) = 1e-10 Identities = 35/79 (44%), Positives = 43/79 (54%), Gaps = 12/79 (15%) Frame = +3 Query: 273 PEPVFVDGHVESP--GGSVKKSKR----------LLEEEHPSWLPEDWRQEFRMRTSGAT 416 P+P+ G P GG SK LL+ PSWLPE+W + R RTSGAT Sbjct: 75 PDPLLGSGSFIDPNNGGDQNASKEAENSPNPSSALLKRTRPSWLPENWEMQLRQRTSGAT 134 Query: 417 AGTYDRYFFSPTGKRFRSK 473 GT DRY+ +P+G R RSK Sbjct: 135 EGTVDRYYIAPSGHRLRSK 153 Score = 25.8 bits (55), Expect(2) = 1e-10 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +2 Query: 470 KTEVLNFLMTGSTKKR 517 K EVLNFL TGS +K+ Sbjct: 153 KNEVLNFLETGSKRKK 168 >XP_016546997.1 PREDICTED: methyl-CpG-binding domain-containing protein 5-like [Capsicum annuum] Length = 266 Score = 66.2 bits (160), Expect = 6e-10 Identities = 33/65 (50%), Positives = 43/65 (66%), Gaps = 1/65 (1%) Frame = +3 Query: 300 VESPGGSVKKSKRLLEEEHPSWLPEDWRQEFRMRTSGATAGTYDRYFFSP-TGKRFRSKP 476 V PG SV+ + E PSWLP+DWR E ++RT+GATAGT DRY++ P +G +FRSK Sbjct: 101 VRKPGRSVE-----VNVERPSWLPDDWRFETKVRTNGATAGTVDRYYYEPVSGTKFRSKT 155 Query: 477 RYSIF 491 F Sbjct: 156 EVLYF 160 >GAQ90283.1 hypothetical protein KFL_006220020 [Klebsormidium flaccidum] Length = 498 Score = 67.0 bits (162), Expect = 7e-10 Identities = 34/71 (47%), Positives = 43/71 (60%), Gaps = 5/71 (7%) Frame = +3 Query: 294 GHVESPGGSVKKSKRL-----LEEEHPSWLPEDWRQEFRMRTSGATAGTYDRYFFSPTGK 458 G ++ G + K KR +E PSWLPE WR E ++R GATAGT D+Y+FSP GK Sbjct: 172 GGEDADGQAAAKRKRYPPTKGVEVGRPSWLPEGWRVEEKVRGQGATAGTKDKYYFSPEGK 231 Query: 459 RFRSKPRYSIF 491 RFRS+ F Sbjct: 232 RFRSRAEIQRF 242 >XP_016483756.1 PREDICTED: methyl-CpG-binding domain-containing protein 5-like [Nicotiana tabacum] Length = 251 Score = 65.9 bits (159), Expect = 7e-10 Identities = 29/42 (69%), Positives = 36/42 (85%), Gaps = 1/42 (2%) Frame = +3 Query: 351 EHPSWLPEDWRQEFRMRTSGATAGTYDRYFFSP-TGKRFRSK 473 E PSWLPE+W+ E R+RTSGATAG+ DRYFF P +G++FRSK Sbjct: 109 ERPSWLPENWKIEMRVRTSGATAGSTDRYFFEPVSGRKFRSK 150 >XP_009787915.1 PREDICTED: methyl-CpG-binding domain-containing protein 5-like [Nicotiana sylvestris] XP_016515299.1 PREDICTED: methyl-CpG-binding domain-containing protein 5-like [Nicotiana tabacum] Length = 251 Score = 65.9 bits (159), Expect = 7e-10 Identities = 29/42 (69%), Positives = 36/42 (85%), Gaps = 1/42 (2%) Frame = +3 Query: 351 EHPSWLPEDWRQEFRMRTSGATAGTYDRYFFSP-TGKRFRSK 473 E PSWLPE+W+ E R+RTSGATAG+ DRYFF P +G++FRSK Sbjct: 109 ERPSWLPENWKIEMRVRTSGATAGSTDRYFFEPVSGRKFRSK 150 >XP_009604783.1 PREDICTED: methyl-CpG-binding domain-containing protein 5-like [Nicotiana tomentosiformis] Length = 251 Score = 65.9 bits (159), Expect = 7e-10 Identities = 29/42 (69%), Positives = 36/42 (85%), Gaps = 1/42 (2%) Frame = +3 Query: 351 EHPSWLPEDWRQEFRMRTSGATAGTYDRYFFSP-TGKRFRSK 473 E PSWLPE+W+ E R+RTSGATAG+ DRYFF P +G++FRSK Sbjct: 109 ERPSWLPENWKIEMRVRTSGATAGSTDRYFFEPVSGRKFRSK 150 >KZV17375.1 methyl-CpG-binding domain-containing protein 5 [Dorcoceras hygrometricum] Length = 226 Score = 64.7 bits (156), Expect = 1e-09 Identities = 43/113 (38%), Positives = 59/113 (52%), Gaps = 2/113 (1%) Frame = +3 Query: 141 RNKNKTEAISVMDPNIQETRTDPFLEFDRFVRDDVIQARRPGPE-PEPVFVDGHVESPGG 317 RN + E+++ P ++ DP L D + I PG + E V V+ P Sbjct: 77 RNDSTVESLA---PERNQSNGDPELLSDAVIYAKPISMLAPGEDWSEAVPKAPRVKDPEE 133 Query: 318 SVKKSKRLLEEEHPSWLPEDWRQEFRMRTSGATAGTYDRYFFSPTGKR-FRSK 473 K+ PSWLP+DW E R+R+SGATAGT DRY+ +P+GKR RSK Sbjct: 134 MAKR---------PSWLPDDWDIELRVRSSGATAGTIDRYYVAPSGKRKLRSK 177 >XP_015056606.1 PREDICTED: methyl-CpG-binding domain-containing protein 5-like [Solanum pennellii] Length = 248 Score = 64.3 bits (155), Expect = 3e-09 Identities = 29/48 (60%), Positives = 35/48 (72%), Gaps = 1/48 (2%) Frame = +3 Query: 351 EHPSWLPEDWRQEFRMRTSGATAGTYDRYFFSP-TGKRFRSKPRYSIF 491 E P+WLPE WR E ++RTSGATAGT DRY++ P TG +FRSK F Sbjct: 97 ERPTWLPESWRFEAKVRTSGATAGTVDRYYYEPVTGSKFRSKTEVLYF 144 >ALO02507.1 MBD5 [Solanum lycopersicum] Length = 248 Score = 64.3 bits (155), Expect = 3e-09 Identities = 29/48 (60%), Positives = 35/48 (72%), Gaps = 1/48 (2%) Frame = +3 Query: 351 EHPSWLPEDWRQEFRMRTSGATAGTYDRYFFSP-TGKRFRSKPRYSIF 491 E P+WLPE WR E ++RTSGATAGT DRY++ P TG +FRSK F Sbjct: 97 ERPTWLPESWRFEAKVRTSGATAGTVDRYYYEPVTGSKFRSKTEVLYF 144 >NP_001316316.1 methyl-CpG-binding domain-containing protein 5 [Solanum lycopersicum] ALN98253.1 MBD5 [Solanum lycopersicum] Length = 248 Score = 64.3 bits (155), Expect = 3e-09 Identities = 29/48 (60%), Positives = 35/48 (72%), Gaps = 1/48 (2%) Frame = +3 Query: 351 EHPSWLPEDWRQEFRMRTSGATAGTYDRYFFSP-TGKRFRSKPRYSIF 491 E P+WLPE WR E ++RTSGATAGT DRY++ P TG +FRSK F Sbjct: 97 ERPTWLPESWRFEAKVRTSGATAGTVDRYYYEPVTGSKFRSKTEVLYF 144 >XP_006362862.1 PREDICTED: methyl-CpG-binding domain-containing protein 5-like [Solanum tuberosum] Length = 245 Score = 62.8 bits (151), Expect = 9e-09 Identities = 28/48 (58%), Positives = 35/48 (72%), Gaps = 1/48 (2%) Frame = +3 Query: 351 EHPSWLPEDWRQEFRMRTSGATAGTYDRYFFSP-TGKRFRSKPRYSIF 491 E P+WLPE WR E ++RTSGATAGT DRY++ P +G +FRSK F Sbjct: 97 ERPTWLPESWRFEAKVRTSGATAGTVDRYYYEPVSGSKFRSKTEVLYF 144 >XP_019164185.1 PREDICTED: methyl-CpG-binding domain-containing protein 5-like [Ipomoea nil] Length = 237 Score = 62.4 bits (150), Expect = 1e-08 Identities = 37/98 (37%), Positives = 58/98 (59%), Gaps = 9/98 (9%) Frame = +3 Query: 204 DPFLEFDRFVRDDV----IQARRPGPEPEPVFVDGHVESPGGSVKKSKR-LLEE---EHP 359 DP L D ++ D+ +++R PE ++ S ++++R +L E E P Sbjct: 38 DPLLRSDAYIEVDMEATPLRSRVVVDPPEMSEDTVTDQAADSSQRRARRKMLPEDAAERP 97 Query: 360 SWLPEDWRQEFRMRTSGATAGTYDRYFFSP-TGKRFRS 470 +WLPE+W+ E R+R SGATAG+ DRY+ P +GK+FRS Sbjct: 98 AWLPENWKMELRVRNSGATAGSIDRYYIDPVSGKKFRS 135 >XP_010264451.1 PREDICTED: uncharacterized protein LOC104602459 isoform X2 [Nelumbo nucifera] Length = 303 Score = 62.4 bits (150), Expect = 2e-08 Identities = 39/101 (38%), Positives = 56/101 (55%), Gaps = 6/101 (5%) Frame = +3 Query: 189 QETRTDPFLEFDRFVRDDVIQARRPGPEP-EPVFVDGHVESPGGSVKKSKRLL----EEE 353 Q +T+P L+F+ +DV + P PE EP+ + G+ K L ++ Sbjct: 98 QIAKTEPELDFEANNSEDV-HMQTPAPEVVEPLSQFPPRKRGRGAAKTGLELAIVPASQD 156 Query: 354 HPSWLPEDWRQEFRMRTSGATAGTYDRYFFSP-TGKRFRSK 473 P WLP WR E R+R+SG TAG DRYF+ P +G++FRSK Sbjct: 157 LPDWLPPGWRMESRVRSSGVTAGMRDRYFYDPVSGRQFRSK 197 >XP_010264450.1 PREDICTED: uncharacterized protein LOC104602459 isoform X1 [Nelumbo nucifera] Length = 304 Score = 62.4 bits (150), Expect = 2e-08 Identities = 39/101 (38%), Positives = 56/101 (55%), Gaps = 6/101 (5%) Frame = +3 Query: 189 QETRTDPFLEFDRFVRDDVIQARRPGPEP-EPVFVDGHVESPGGSVKKSKRLL----EEE 353 Q +T+P L+F+ +DV + P PE EP+ + G+ K L ++ Sbjct: 98 QIAKTEPELDFEANNSEDV-HMQTPAPEVVEPLSQFPPRKRGRGAAKTGLELAIVPASQD 156 Query: 354 HPSWLPEDWRQEFRMRTSGATAGTYDRYFFSP-TGKRFRSK 473 P WLP WR E R+R+SG TAG DRYF+ P +G++FRSK Sbjct: 157 LPDWLPPGWRMESRVRSSGVTAGMRDRYFYDPVSGRQFRSK 197 >XP_012838519.1 PREDICTED: methyl-CpG-binding domain-containing protein 5-like [Erythranthe guttata] EYU36047.1 hypothetical protein MIMGU_mgv1a013651mg [Erythranthe guttata] Length = 214 Score = 61.2 bits (147), Expect = 2e-08 Identities = 40/123 (32%), Positives = 57/123 (46%), Gaps = 25/123 (20%) Frame = +3 Query: 180 PNIQETRTDPFLEFDRFVRDDVIQARRPGPE--------------------PEPVFV--- 290 P T DP L+ F+ D + PE EP+ + Sbjct: 24 PAADPTSPDPLLDSGAFIDPDRNNSGAESPENQQDEDNAENVNFEPGVVIAAEPISMLRP 83 Query: 291 -DGHVESPGGSVKKSKRLLEEEHPSWLPEDWRQEFRMRTSGATAGTYDRYFFSPTGKR-F 464 + VE+ +V++ + PSWLPEDW+ + R+R+SGATAG DRY+ P+G R F Sbjct: 84 GESSVETTARAVRRRDPDEMLKRPSWLPEDWKIDLRVRSSGATAGLIDRYYVEPSGNRKF 143 Query: 465 RSK 473 RSK Sbjct: 144 RSK 146 >XP_008223622.1 PREDICTED: methyl-CpG-binding domain-containing protein 5-like [Prunus mume] Length = 244 Score = 61.2 bits (147), Expect = 3e-08 Identities = 45/136 (33%), Positives = 64/136 (47%), Gaps = 25/136 (18%) Frame = +3 Query: 141 RNKNKTEAISVMDPNIQETRT---------DPFLEFDRFVRD--------DVIQARRPGP 269 +N N+T + PN + R DP L F+ +V +A++P Sbjct: 9 QNLNRTRSTPDRRPNYPDYRAGTLNSDIPPDPLLRPGSFIDSTTRTSNGQNVKEAQKPRR 68 Query: 270 EPE------PVFVDGHVESPGGSVKKSKRL-LEEEHPSWLPEDWRQEFRMRTSGATAGTY 428 PE P +E+P G + KR E +WLP+ W E R+R SGATAG+ Sbjct: 69 APEQSKCAEPATSGSGMENPDGGAGRVKRKGFVEPLENWLPQGWSVEERVRASGATAGST 128 Query: 429 DRYFFSP-TGKRFRSK 473 DRY+ P +G+RFRSK Sbjct: 129 DRYYVDPVSGRRFRSK 144 >XP_011090325.1 PREDICTED: methyl-CpG-binding domain-containing protein 5-like [Sesamum indicum] Length = 206 Score = 60.5 bits (145), Expect = 4e-08 Identities = 29/62 (46%), Positives = 40/62 (64%), Gaps = 1/62 (1%) Frame = +3 Query: 291 DGHVESPGGSVKKSKRLLEEEHPSWLPEDWRQEFRMRTSGATAGTYDRYFFSPTGKR-FR 467 + E+ SV++ + PSWLPEDW+ + R+R SGATAG DRY+ P+G+R FR Sbjct: 80 ENSAEAAPRSVRRRNPEEMSKRPSWLPEDWQIDLRVRASGATAGLIDRYYVEPSGQRKFR 139 Query: 468 SK 473 SK Sbjct: 140 SK 141 >EPS60413.1 hypothetical protein M569_14391, partial [Genlisea aurea] Length = 216 Score = 58.5 bits (140), Expect(2) = 5e-08 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 3/50 (6%) Frame = +3 Query: 333 KRLLEE--EHPSWLPEDWRQEFRMRTSGATAGTYDRYFFSPTG-KRFRSK 473 K+ LEE + PSWLPEDW + ++R SGA+ G DRY+ PTG +RFRSK Sbjct: 82 KKSLEEMAKRPSWLPEDWTMDLKIRNSGASKGHIDRYYAEPTGQRRFRSK 131 Score = 25.8 bits (55), Expect(2) = 5e-08 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +2 Query: 470 KTEVLNFLMTGSTKKRK 520 KTEVL+FL +G +KRK Sbjct: 131 KTEVLHFLESGGQRKRK 147 >XP_006291907.1 hypothetical protein CARUB_v10018084mg [Capsella rubella] EOA24805.1 hypothetical protein CARUB_v10018084mg [Capsella rubella] Length = 184 Score = 59.7 bits (143), Expect = 6e-08 Identities = 30/70 (42%), Positives = 41/70 (58%), Gaps = 1/70 (1%) Frame = +3 Query: 267 PEPEPVFVDGHVESPGGSVKKSKRLLEEEHPSWLPEDWRQEFRMRTSGATAGTYDRYFFS 446 P PE + +P S K KR + +WLP DWR E R+RTSG AG D++++ Sbjct: 10 PPPE------NTANPVDSSKSRKRATPGDDNNWLPPDWRTEVRVRTSGTKAGVVDKFYYE 63 Query: 447 P-TGKRFRSK 473 P TG++FRSK Sbjct: 64 PITGRKFRSK 73