BLASTX nr result
ID: Lithospermum23_contig00011596
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00011596 (257 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAU66634.1 Transcription factor MYB3, partial [Noccaea caerulesc... 58 5e-08 JAU85663.1 Transcription factor MYB3, partial [Noccaea caerulesc... 58 5e-08 XP_013629672.1 PREDICTED: transcription repressor MYB4 [Brassica... 58 5e-08 XP_013652821.1 PREDICTED: transcription repressor MYB4-like [Bra... 58 5e-08 AAL90655.1 R2R3 Myb protein, partial [Zea mays] 54 8e-08 AGS55355.1 R2R3 MYB transcription factor 29, partial [Salvia mil... 54 2e-07 ACR18910.1 transcription factor MYBZ2, partial [Glycine max] 54 2e-07 EYU40434.1 hypothetical protein MIMGU_mgv1a021457mg [Erythranthe... 54 2e-07 XP_006654438.1 PREDICTED: myb-related protein 308 [Oryza brachya... 54 2e-07 EMT26190.1 Transcription repressor MYB4 [Aegilops tauschii] 54 2e-07 JAU33411.1 Transcription factor MYB32, partial [Noccaea caerules... 57 2e-07 XP_006305372.1 hypothetical protein CARUB_v10009761mg [Capsella ... 56 2e-07 JAT58591.1 Myb-related protein 308, partial [Anthurium amnicola] 54 2e-07 KGN62248.1 hypothetical protein Csa_2G343150 [Cucumis sativus] 53 2e-07 EMS60506.1 Transcription repressor MYB4 [Triticum urartu] 53 3e-07 JAT43214.1 Myb-related protein 308, partial [Anthurium amnicola] 54 3e-07 JAU24136.1 Transcription factor MYB32, partial [Noccaea caerules... 56 3e-07 NP_001170687.1 putative MYB DNA-binding domain superfamily prote... 54 3e-07 KHN19997.1 Myb-related protein 308 [Glycine soja] 55 3e-07 CAA50225.1 MybHv5, partial [Hordeum vulgare subsp. vulgare] 53 3e-07 >JAU66634.1 Transcription factor MYB3, partial [Noccaea caerulescens] Length = 300 Score = 58.2 bits (139), Expect = 5e-08 Identities = 26/31 (83%), Positives = 28/31 (90%), Gaps = 1/31 (3%) Frame = +2 Query: 167 IQRD-REREMGRSPCCEKSHTNKGAWTKEED 256 I RD R+REMGRSPCCEK+H NKGAWTKEED Sbjct: 25 IYRDPRKREMGRSPCCEKAHMNKGAWTKEED 55 >JAU85663.1 Transcription factor MYB3, partial [Noccaea caerulescens] Length = 301 Score = 58.2 bits (139), Expect = 5e-08 Identities = 26/31 (83%), Positives = 28/31 (90%), Gaps = 1/31 (3%) Frame = +2 Query: 167 IQRD-REREMGRSPCCEKSHTNKGAWTKEED 256 I RD R+REMGRSPCCEK+H NKGAWTKEED Sbjct: 26 IYRDPRKREMGRSPCCEKAHMNKGAWTKEED 56 >XP_013629672.1 PREDICTED: transcription repressor MYB4 [Brassica oleracea var. oleracea] Length = 303 Score = 58.2 bits (139), Expect = 5e-08 Identities = 22/29 (75%), Positives = 27/29 (93%) Frame = +2 Query: 170 QRDREREMGRSPCCEKSHTNKGAWTKEED 256 ++ +E+ MGRSPCCEK+HTNKGAWTKEED Sbjct: 16 RKQKEKSMGRSPCCEKAHTNKGAWTKEED 44 >XP_013652821.1 PREDICTED: transcription repressor MYB4-like [Brassica napus] XP_013685716.1 PREDICTED: transcription repressor MYB4-like [Brassica napus] CDY12092.1 BnaC03g60080D [Brassica napus] Length = 304 Score = 58.2 bits (139), Expect = 5e-08 Identities = 22/29 (75%), Positives = 27/29 (93%) Frame = +2 Query: 170 QRDREREMGRSPCCEKSHTNKGAWTKEED 256 ++ +E+ MGRSPCCEK+HTNKGAWTKEED Sbjct: 16 RKQKEKSMGRSPCCEKAHTNKGAWTKEED 44 >AAL90655.1 R2R3 Myb protein, partial [Zea mays] Length = 57 Score = 53.5 bits (127), Expect = 8e-08 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +2 Query: 191 MGRSPCCEKSHTNKGAWTKEED 256 MGRSPCCEK+HTNKGAWTKEED Sbjct: 1 MGRSPCCEKAHTNKGAWTKEED 22 >AGS55355.1 R2R3 MYB transcription factor 29, partial [Salvia miltiorrhiza] Length = 87 Score = 53.5 bits (127), Expect = 2e-07 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +2 Query: 191 MGRSPCCEKSHTNKGAWTKEED 256 MGRSPCCEK+HTNKGAWTKEED Sbjct: 1 MGRSPCCEKAHTNKGAWTKEED 22 >ACR18910.1 transcription factor MYBZ2, partial [Glycine max] Length = 87 Score = 53.5 bits (127), Expect = 2e-07 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +2 Query: 191 MGRSPCCEKSHTNKGAWTKEED 256 MGRSPCCEK+HTNKGAWTKEED Sbjct: 1 MGRSPCCEKAHTNKGAWTKEED 22 >EYU40434.1 hypothetical protein MIMGU_mgv1a021457mg [Erythranthe guttata] Length = 88 Score = 53.5 bits (127), Expect = 2e-07 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +2 Query: 191 MGRSPCCEKSHTNKGAWTKEED 256 MGRSPCCEK+HTNKGAWTKEED Sbjct: 1 MGRSPCCEKAHTNKGAWTKEED 22 >XP_006654438.1 PREDICTED: myb-related protein 308 [Oryza brachyantha] Length = 88 Score = 53.5 bits (127), Expect = 2e-07 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +2 Query: 191 MGRSPCCEKSHTNKGAWTKEED 256 MGRSPCCEK+HTNKGAWTKEED Sbjct: 1 MGRSPCCEKAHTNKGAWTKEED 22 >EMT26190.1 Transcription repressor MYB4 [Aegilops tauschii] Length = 88 Score = 53.5 bits (127), Expect = 2e-07 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +2 Query: 191 MGRSPCCEKSHTNKGAWTKEED 256 MGRSPCCEK+HTNKGAWTKEED Sbjct: 1 MGRSPCCEKAHTNKGAWTKEED 22 >JAU33411.1 Transcription factor MYB32, partial [Noccaea caerulescens] Length = 321 Score = 56.6 bits (135), Expect = 2e-07 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = +2 Query: 143 KQKARNKEIQRDREREMGRSPCCEKSHTNKGAWTKEED 256 +Q ++ E + + E MGRSPCCEK H NKGAWTKEED Sbjct: 18 QQHHKHTEEEEEEEEAMGRSPCCEKEHMNKGAWTKEED 55 >XP_006305372.1 hypothetical protein CARUB_v10009761mg [Capsella rubella] EOA38270.1 hypothetical protein CARUB_v10009761mg [Capsella rubella] Length = 321 Score = 56.2 bits (134), Expect = 2e-07 Identities = 25/38 (65%), Positives = 29/38 (76%), Gaps = 5/38 (13%) Frame = +2 Query: 158 NKEIQRDRER-----EMGRSPCCEKSHTNKGAWTKEED 256 +++ RDR R EMGRSPCCEK+H NKGAWTKEED Sbjct: 32 HRDTYRDRRRRRTFKEMGRSPCCEKAHMNKGAWTKEED 69 >JAT58591.1 Myb-related protein 308, partial [Anthurium amnicola] Length = 103 Score = 53.5 bits (127), Expect = 2e-07 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +2 Query: 191 MGRSPCCEKSHTNKGAWTKEED 256 MGRSPCCEK+HTNKGAWTKEED Sbjct: 1 MGRSPCCEKAHTNKGAWTKEED 22 >KGN62248.1 hypothetical protein Csa_2G343150 [Cucumis sativus] Length = 88 Score = 53.1 bits (126), Expect = 2e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +2 Query: 191 MGRSPCCEKSHTNKGAWTKEED 256 MGRSPCCEK HTNKGAWTKEED Sbjct: 1 MGRSPCCEKQHTNKGAWTKEED 22 >EMS60506.1 Transcription repressor MYB4 [Triticum urartu] Length = 96 Score = 53.1 bits (126), Expect = 3e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +2 Query: 191 MGRSPCCEKSHTNKGAWTKEED 256 MGRSPCCEK HTNKGAWTKEED Sbjct: 1 MGRSPCCEKEHTNKGAWTKEED 22 >JAT43214.1 Myb-related protein 308, partial [Anthurium amnicola] Length = 112 Score = 53.5 bits (127), Expect = 3e-07 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +2 Query: 191 MGRSPCCEKSHTNKGAWTKEED 256 MGRSPCCEK+HTNKGAWTKEED Sbjct: 1 MGRSPCCEKAHTNKGAWTKEED 22 >JAU24136.1 Transcription factor MYB32, partial [Noccaea caerulescens] Length = 303 Score = 55.8 bits (133), Expect = 3e-07 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = +2 Query: 155 RNKEIQRDREREMGRSPCCEKSHTNKGAWTKEED 256 ++ E + + E MGRSPCCEK H NKGAWTKEED Sbjct: 4 KSSEEEEEEEEAMGRSPCCEKEHMNKGAWTKEED 37 >NP_001170687.1 putative MYB DNA-binding domain superfamily protein [Zea mays] ACR34498.1 unknown [Zea mays] Length = 115 Score = 53.5 bits (127), Expect = 3e-07 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +2 Query: 191 MGRSPCCEKSHTNKGAWTKEED 256 MGRSPCCEK+HTNKGAWTKEED Sbjct: 1 MGRSPCCEKAHTNKGAWTKEED 22 >KHN19997.1 Myb-related protein 308 [Glycine soja] Length = 240 Score = 55.5 bits (132), Expect = 3e-07 Identities = 22/25 (88%), Positives = 23/25 (92%) Frame = +2 Query: 182 EREMGRSPCCEKSHTNKGAWTKEED 256 E MGRSPCCEK+HTNKGAWTKEED Sbjct: 28 EHRMGRSPCCEKAHTNKGAWTKEED 52 >CAA50225.1 MybHv5, partial [Hordeum vulgare subsp. vulgare] Length = 104 Score = 53.1 bits (126), Expect = 3e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +2 Query: 191 MGRSPCCEKSHTNKGAWTKEED 256 MGRSPCCEK HTNKGAWTKEED Sbjct: 1 MGRSPCCEKEHTNKGAWTKEED 22