BLASTX nr result
ID: Lithospermum23_contig00011343
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00011343 (417 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011071644.1 PREDICTED: protein DCL, chloroplastic [Sesamum in... 90 7e-20 XP_011087245.1 PREDICTED: protein DCL, chloroplastic-like [Sesam... 90 2e-19 XP_016569978.1 PREDICTED: protein DCL, chloroplastic-like [Capsi... 86 4e-18 CDP12303.1 unnamed protein product [Coffea canephora] 85 2e-17 XP_009587068.1 PREDICTED: protein DCL, chloroplastic-like [Nicot... 85 2e-17 XP_019225612.1 PREDICTED: protein DCL, chloroplastic-like [Nicot... 85 2e-17 XP_009768743.1 PREDICTED: protein DCL, chloroplastic-like [Nicot... 85 2e-17 XP_017249954.1 PREDICTED: protein DCL, chloroplastic [Daucus car... 84 3e-17 XP_004241584.1 PREDICTED: protein DCL, chloroplastic-like [Solan... 84 4e-17 XP_007138179.1 hypothetical protein PHAVU_009G187000g [Phaseolus... 83 1e-16 XP_006354776.1 PREDICTED: protein DCL, chloroplastic-like [Solan... 82 2e-16 XP_012570914.1 PREDICTED: protein DCL, chloroplastic-like [Cicer... 82 2e-16 KHN32529.1 Protein DCL, chloroplastic [Glycine soja] 79 3e-16 XP_014495373.1 PREDICTED: keratin, type I cytoskeletal 10-like [... 82 3e-16 XP_012569052.1 PREDICTED: uncharacterized protein LOC101492280 [... 79 3e-16 KHN26248.1 DNA-directed RNA polymerase E subunit 1 [Glycine soja] 79 3e-16 XP_015077231.1 PREDICTED: protein DCL, chloroplastic-like [Solan... 81 3e-16 XP_017420798.1 PREDICTED: protein DCL, chloroplastic-like [Vigna... 80 1e-15 GAU38730.1 hypothetical protein TSUD_208410 [Trifolium subterran... 79 1e-15 EPS64007.1 hypothetical protein M569_10774 [Genlisea aurea] 79 2e-15 >XP_011071644.1 PREDICTED: protein DCL, chloroplastic [Sesamum indicum] Length = 182 Score = 89.7 bits (221), Expect = 7e-20 Identities = 38/46 (82%), Positives = 44/46 (95%) Frame = -3 Query: 415 PQYKSRCFFLLREDDSVDDFSFRKCVNHILPLPENMQLNHDDNKAF 278 PQ+KSRCFFL+RED+SVDDFSFRKC++HILPLPENMQ+ HD NKAF Sbjct: 119 PQFKSRCFFLIREDNSVDDFSFRKCIDHILPLPENMQIKHDVNKAF 164 >XP_011087245.1 PREDICTED: protein DCL, chloroplastic-like [Sesamum indicum] Length = 221 Score = 89.7 bits (221), Expect = 2e-19 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -3 Query: 415 PQYKSRCFFLLREDDSVDDFSFRKCVNHILPLPENMQLNHDDNKA 281 PQ+KSRCFFL+RED+SVDDFSFRKCVNHILPLPENMQ+ HD NKA Sbjct: 158 PQFKSRCFFLIREDESVDDFSFRKCVNHILPLPENMQVKHDVNKA 202 >XP_016569978.1 PREDICTED: protein DCL, chloroplastic-like [Capsicum annuum] Length = 230 Score = 86.3 bits (212), Expect = 4e-18 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = -3 Query: 415 PQYKSRCFFLLREDDSVDDFSFRKCVNHILPLPENMQLNHDDNKAFS 275 PQ+KSRCFF++RED SVDDFSFRKCV+HILPLPENMQ+ HD NKA + Sbjct: 166 PQFKSRCFFVIREDGSVDDFSFRKCVDHILPLPENMQVKHDANKALA 212 >CDP12303.1 unnamed protein product [Coffea canephora] Length = 246 Score = 85.1 bits (209), Expect = 2e-17 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -3 Query: 415 PQYKSRCFFLLREDDSVDDFSFRKCVNHILPLPENMQLNHDDNK 284 P++KSRCFFL REDDSVDDFSFRKCV+HILPLPENMQ+ HD NK Sbjct: 173 PKFKSRCFFLTREDDSVDDFSFRKCVDHILPLPENMQVKHDVNK 216 >XP_009587068.1 PREDICTED: protein DCL, chloroplastic-like [Nicotiana tomentosiformis] Length = 229 Score = 84.7 bits (208), Expect = 2e-17 Identities = 36/47 (76%), Positives = 43/47 (91%) Frame = -3 Query: 415 PQYKSRCFFLLREDDSVDDFSFRKCVNHILPLPENMQLNHDDNKAFS 275 PQ+KSRCFF++RED SVDDFSFRKCV+HILPLPENMQ+ H+ NKA + Sbjct: 164 PQFKSRCFFVIREDGSVDDFSFRKCVDHILPLPENMQVKHEANKALA 210 >XP_019225612.1 PREDICTED: protein DCL, chloroplastic-like [Nicotiana attenuata] OIT32550.1 hypothetical protein A4A49_13358 [Nicotiana attenuata] Length = 235 Score = 84.7 bits (208), Expect = 2e-17 Identities = 36/47 (76%), Positives = 43/47 (91%) Frame = -3 Query: 415 PQYKSRCFFLLREDDSVDDFSFRKCVNHILPLPENMQLNHDDNKAFS 275 PQ+KSRCFF++RED SVDDFSFRKCV+HILPLPENMQ+ H+ NKA + Sbjct: 164 PQFKSRCFFVIREDGSVDDFSFRKCVDHILPLPENMQVKHEANKALA 210 >XP_009768743.1 PREDICTED: protein DCL, chloroplastic-like [Nicotiana sylvestris] XP_016494795.1 PREDICTED: protein DCL, chloroplastic-like [Nicotiana tabacum] Length = 235 Score = 84.7 bits (208), Expect = 2e-17 Identities = 36/47 (76%), Positives = 43/47 (91%) Frame = -3 Query: 415 PQYKSRCFFLLREDDSVDDFSFRKCVNHILPLPENMQLNHDDNKAFS 275 PQ+KSRCFF++RED SVDDFSFRKCV+HILPLPENMQ+ H+ NKA + Sbjct: 164 PQFKSRCFFVIREDGSVDDFSFRKCVDHILPLPENMQVKHEANKALA 210 >XP_017249954.1 PREDICTED: protein DCL, chloroplastic [Daucus carota subsp. sativus] KZM93318.1 hypothetical protein DCAR_016563 [Daucus carota subsp. sativus] Length = 204 Score = 83.6 bits (205), Expect = 3e-17 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -3 Query: 415 PQYKSRCFFLLREDDSVDDFSFRKCVNHILPLPENMQLNHDDNKA 281 P++KSRCFFL+R DDSVDDFSFRKCV+HILPLPENMQL D NKA Sbjct: 136 PEFKSRCFFLIRNDDSVDDFSFRKCVDHILPLPENMQLKPDVNKA 180 >XP_004241584.1 PREDICTED: protein DCL, chloroplastic-like [Solanum lycopersicum] Length = 227 Score = 83.6 bits (205), Expect = 4e-17 Identities = 34/44 (77%), Positives = 41/44 (93%) Frame = -3 Query: 415 PQYKSRCFFLLREDDSVDDFSFRKCVNHILPLPENMQLNHDDNK 284 PQYKSRCFF++REDDSVDDFSFRKC++HI PLPENMQ+ H+ N+ Sbjct: 163 PQYKSRCFFIIREDDSVDDFSFRKCIDHISPLPENMQVKHEANR 206 >XP_007138179.1 hypothetical protein PHAVU_009G187000g [Phaseolus vulgaris] ESW10173.1 hypothetical protein PHAVU_009G187000g [Phaseolus vulgaris] Length = 248 Score = 82.8 bits (203), Expect = 1e-16 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = -3 Query: 415 PQYKSRCFFLLREDDSVDDFSFRKCVNHILPLPENMQLNHDDNKAFSS 272 P YKSRCFFL+REDDS DDFSFRKCV+HILPLPE+M L D NKA S Sbjct: 164 PTYKSRCFFLIREDDSADDFSFRKCVDHILPLPEDMHLKSDANKALGS 211 >XP_006354776.1 PREDICTED: protein DCL, chloroplastic-like [Solanum tuberosum] Length = 226 Score = 82.0 bits (201), Expect = 2e-16 Identities = 34/44 (77%), Positives = 41/44 (93%) Frame = -3 Query: 415 PQYKSRCFFLLREDDSVDDFSFRKCVNHILPLPENMQLNHDDNK 284 PQ+KSRCFF++REDDSVDDFSFRKCV+HI PLPENMQ+ H+ N+ Sbjct: 162 PQFKSRCFFVIREDDSVDDFSFRKCVDHISPLPENMQVKHEANR 205 >XP_012570914.1 PREDICTED: protein DCL, chloroplastic-like [Cicer arietinum] Length = 228 Score = 81.6 bits (200), Expect = 2e-16 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -3 Query: 415 PQYKSRCFFLLREDDSVDDFSFRKCVNHILPLPENMQLNHDDNKAF 278 P +KSRC+FL+REDDSVDDFSFRKCV+HILPLPE MQL ++ NK F Sbjct: 151 PHFKSRCYFLIREDDSVDDFSFRKCVDHILPLPEEMQLKNEANKRF 196 >KHN32529.1 Protein DCL, chloroplastic [Glycine soja] Length = 136 Score = 79.3 bits (194), Expect = 3e-16 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = -3 Query: 415 PQYKSRCFFLLREDDSVDDFSFRKCVNHILPLPENMQLNHDDNKA 281 P +KSRCFFL+REDDS DDFSFRKCV+HILPLPE M L D NKA Sbjct: 54 PTFKSRCFFLIREDDSADDFSFRKCVDHILPLPEEMHLKSDANKA 98 >XP_014495373.1 PREDICTED: keratin, type I cytoskeletal 10-like [Vigna radiata var. radiata] Length = 257 Score = 82.0 bits (201), Expect = 3e-16 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = -3 Query: 415 PQYKSRCFFLLREDDSVDDFSFRKCVNHILPLPENMQLNHDDNKAF 278 P Y+SRCFFL+REDDSVDDFSFRKCV+HILPLP+ M L D NKAF Sbjct: 172 PTYQSRCFFLIREDDSVDDFSFRKCVDHILPLPDGMHLKSDANKAF 217 >XP_012569052.1 PREDICTED: uncharacterized protein LOC101492280 [Cicer arietinum] XP_012572537.1 PREDICTED: uncharacterized protein LOC105852283 [Cicer arietinum] Length = 125 Score = 79.0 bits (193), Expect = 3e-16 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = -3 Query: 415 PQYKSRCFFLLREDDSVDDFSFRKCVNHILPLPENMQLNHDDNKA 281 P +KS+CFFL+RED+S DDFSFRKCV+HILPLPE MQ+ HD N+A Sbjct: 54 PMWKSKCFFLIREDESADDFSFRKCVDHILPLPEAMQVKHDANRA 98 >KHN26248.1 DNA-directed RNA polymerase E subunit 1 [Glycine soja] Length = 139 Score = 79.3 bits (194), Expect = 3e-16 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = -3 Query: 415 PQYKSRCFFLLREDDSVDDFSFRKCVNHILPLPENMQLNHDDNKA 281 P +KSRCFFL+REDDS DDFSFRKCV+HILPLPE M L D NKA Sbjct: 54 PTFKSRCFFLIREDDSADDFSFRKCVDHILPLPEEMHLKFDANKA 98 >XP_015077231.1 PREDICTED: protein DCL, chloroplastic-like [Solanum pennellii] Length = 227 Score = 81.3 bits (199), Expect = 3e-16 Identities = 33/44 (75%), Positives = 40/44 (90%) Frame = -3 Query: 415 PQYKSRCFFLLREDDSVDDFSFRKCVNHILPLPENMQLNHDDNK 284 PQYKSRCFF++REDD VDDFSFRKC++HI PLPENMQ+ H+ N+ Sbjct: 163 PQYKSRCFFIIREDDFVDDFSFRKCIDHISPLPENMQVKHEANR 206 >XP_017420798.1 PREDICTED: protein DCL, chloroplastic-like [Vigna angularis] KOM40314.1 hypothetical protein LR48_Vigan04g051200 [Vigna angularis] BAT79645.1 hypothetical protein VIGAN_02256000 [Vigna angularis var. angularis] Length = 251 Score = 80.1 bits (196), Expect = 1e-15 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -3 Query: 415 PQYKSRCFFLLREDDSVDDFSFRKCVNHILPLPENMQLNHDDNKAF 278 P Y+SRCFFL+REDDSVDDFSFRKCV+HILPLP+ M L D NK F Sbjct: 166 PTYQSRCFFLIREDDSVDDFSFRKCVDHILPLPDGMHLKSDANKEF 211 >GAU38730.1 hypothetical protein TSUD_208410 [Trifolium subterraneum] Length = 197 Score = 79.0 bits (193), Expect = 1e-15 Identities = 33/47 (70%), Positives = 41/47 (87%) Frame = -3 Query: 415 PQYKSRCFFLLREDDSVDDFSFRKCVNHILPLPENMQLNHDDNKAFS 275 P +KS+CFFL++ED+S DDFSFRKCV+HILPLPE MQ+ HD NKA + Sbjct: 134 PTWKSKCFFLIKEDESADDFSFRKCVDHILPLPEAMQVKHDANKALA 180 >EPS64007.1 hypothetical protein M569_10774 [Genlisea aurea] Length = 198 Score = 79.0 bits (193), Expect = 2e-15 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = -3 Query: 415 PQYKSRCFFLLREDDSVDDFSFRKCVNHILPLPENMQLNHDDNKA 281 PQYKSRCFFL+RED+S DDFSFRKCV+ ++PLPENMQ+ D N+A Sbjct: 133 PQYKSRCFFLVREDESADDFSFRKCVDRLIPLPENMQVQQDANRA 177