BLASTX nr result
ID: Lithospermum23_contig00010952
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00010952 (360 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016188250.1 PREDICTED: 39S ribosomal protein L47, mitochondri... 60 5e-09 XP_015972810.1 PREDICTED: 39S ribosomal protein L47, mitochondri... 60 7e-09 XP_015953737.1 PREDICTED: 39S ribosomal protein L47, mitochondri... 60 7e-09 XP_010546019.1 PREDICTED: 39S ribosomal protein L47, mitochondri... 59 1e-08 XP_013716127.1 PREDICTED: 39S ribosomal protein L47, mitochondri... 59 2e-08 CDP18073.1 unnamed protein product [Coffea canephora] 59 2e-08 XP_018490751.1 PREDICTED: 39S ribosomal protein L47, mitochondri... 59 2e-08 XP_013605167.1 PREDICTED: 39S ribosomal protein L47, mitochondri... 59 2e-08 XP_014495313.1 PREDICTED: 39S ribosomal protein L47, mitochondri... 58 3e-08 XP_017438695.1 PREDICTED: 39S ribosomal protein L47, mitochondri... 58 3e-08 XP_009397507.1 PREDICTED: 39S ribosomal protein L47, mitochondri... 58 3e-08 XP_009118414.1 PREDICTED: 39S ribosomal protein L47, mitochondri... 58 3e-08 XP_007138200.1 hypothetical protein PHAVU_009G188900g [Phaseolus... 58 4e-08 XP_006840519.1 PREDICTED: 39S ribosomal protein L47, mitochondri... 57 5e-08 XP_013641145.1 PREDICTED: 39S ribosomal protein L47, mitochondri... 57 5e-08 XP_013584052.1 PREDICTED: 39S ribosomal protein L47, mitochondri... 57 5e-08 XP_009148030.1 PREDICTED: 39S ribosomal protein L47, mitochondri... 57 5e-08 XP_013708376.1 PREDICTED: 39S ribosomal protein L47, mitochondri... 57 5e-08 XP_018465857.1 PREDICTED: 39S ribosomal protein L47, mitochondri... 57 6e-08 CDX93615.1 BnaA06g04330D [Brassica napus] 57 6e-08 >XP_016188250.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Arachis ipaensis] XP_016188251.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Arachis ipaensis] XP_016188252.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Arachis ipaensis] XP_016188253.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Arachis ipaensis] XP_016188254.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Arachis ipaensis] XP_016188255.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Arachis ipaensis] XP_016188256.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Arachis ipaensis] XP_016188257.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Arachis ipaensis] Length = 145 Score = 60.1 bits (144), Expect = 5e-09 Identities = 32/64 (50%), Positives = 37/64 (57%), Gaps = 1/64 (1%) Frame = +3 Query: 171 MSMIRALGRTLFXXXXXXXXXXXXXXXXXM-GRIAQNPLEEFFEVDRTMEAEKPVVYGRG 347 M + R GRTLF G +NPLEEFFEVDR ME++KP+VYGRG Sbjct: 1 MYLSRTFGRTLFAAAARSRTYASSAGTATAAGDKTRNPLEEFFEVDRDMESDKPIVYGRG 60 Query: 348 WKAS 359 WKAS Sbjct: 61 WKAS 64 >XP_015972810.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Arachis duranensis] Length = 145 Score = 59.7 bits (143), Expect = 7e-09 Identities = 32/64 (50%), Positives = 37/64 (57%), Gaps = 1/64 (1%) Frame = +3 Query: 171 MSMIRALGRTLFXXXXXXXXXXXXXXXXXM-GRIAQNPLEEFFEVDRTMEAEKPVVYGRG 347 M + R GRTLF G +NPLEEFFEVDR ME++KP+VYGRG Sbjct: 1 MYLSRTFGRTLFAAAARSRTYASSAGAATASGDKPRNPLEEFFEVDRDMESDKPIVYGRG 60 Query: 348 WKAS 359 WKAS Sbjct: 61 WKAS 64 >XP_015953737.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Arachis duranensis] XP_015953738.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Arachis duranensis] XP_015953739.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Arachis duranensis] XP_015953740.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Arachis duranensis] XP_015953741.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Arachis duranensis] Length = 145 Score = 59.7 bits (143), Expect = 7e-09 Identities = 32/64 (50%), Positives = 37/64 (57%), Gaps = 1/64 (1%) Frame = +3 Query: 171 MSMIRALGRTLFXXXXXXXXXXXXXXXXXM-GRIAQNPLEEFFEVDRTMEAEKPVVYGRG 347 M + R GRTLF G +NPLEEFFEVDR ME++KP+VYGRG Sbjct: 1 MYLSRTFGRTLFAAAARSRTYASSAGTATAAGDKPRNPLEEFFEVDRDMESDKPIVYGRG 60 Query: 348 WKAS 359 WKAS Sbjct: 61 WKAS 64 >XP_010546019.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Tarenaya hassleriana] Length = 145 Score = 59.3 bits (142), Expect = 1e-08 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 261 GRIAQNPLEEFFEVDRTMEAEKPVVYGRGWKAS 359 GR A+NPLEEFFEVDR+ E +KP+VYGR WKAS Sbjct: 32 GRTAKNPLEEFFEVDRSQEEDKPIVYGRSWKAS 64 >XP_013716127.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Brassica napus] CDY06281.1 BnaA09g49220D [Brassica napus] Length = 143 Score = 58.5 bits (140), Expect = 2e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +3 Query: 264 RIAQNPLEEFFEVDRTMEAEKPVVYGRGWKAS 359 RIA+NPLEEFFE DR+ + +KPVVYGRGWKAS Sbjct: 31 RIAKNPLEEFFEFDRSQDEDKPVVYGRGWKAS 62 >CDP18073.1 unnamed protein product [Coffea canephora] Length = 146 Score = 58.5 bits (140), Expect = 2e-08 Identities = 32/65 (49%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 171 MSMIRALGRTLFXXXXXXXXXXXXXXXXXMG--RIAQNPLEEFFEVDRTMEAEKPVVYGR 344 MS IRA+GRTLF R NPLE FFE DR+ + +KPVVYGR Sbjct: 1 MSAIRAIGRTLFAAVKADTSSASSAAAAAASTARTKHNPLENFFEADRSPDDDKPVVYGR 60 Query: 345 GWKAS 359 GWKAS Sbjct: 61 GWKAS 65 >XP_018490751.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Raphanus sativus] XP_018490752.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Raphanus sativus] Length = 147 Score = 58.5 bits (140), Expect = 2e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +3 Query: 264 RIAQNPLEEFFEVDRTMEAEKPVVYGRGWKAS 359 RIA+NPLEEFFE DR+ + +KPVVYGRGWKAS Sbjct: 35 RIAKNPLEEFFEFDRSQDEDKPVVYGRGWKAS 66 >XP_013605167.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Brassica oleracea var. oleracea] XP_013693548.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Brassica napus] CDY22718.1 BnaC08g43520D [Brassica napus] Length = 147 Score = 58.5 bits (140), Expect = 2e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +3 Query: 264 RIAQNPLEEFFEVDRTMEAEKPVVYGRGWKAS 359 RIA+NPLEEFFE DR+ + +KPVVYGRGWKAS Sbjct: 35 RIAKNPLEEFFEFDRSQDEDKPVVYGRGWKAS 66 >XP_014495313.1 PREDICTED: 39S ribosomal protein L47, mitochondrial [Vigna radiata var. radiata] XP_014495314.1 PREDICTED: 39S ribosomal protein L47, mitochondrial [Vigna radiata var. radiata] Length = 142 Score = 58.2 bits (139), Expect = 3e-08 Identities = 31/63 (49%), Positives = 37/63 (58%) Frame = +3 Query: 171 MSMIRALGRTLFXXXXXXXXXXXXXXXXXMGRIAQNPLEEFFEVDRTMEAEKPVVYGRGW 350 M + R LGRTLF GR +NPL+EFFE DR+ + +KPVVYGRGW Sbjct: 1 MFLSRTLGRTLFSAAARSKHYTTAAPAG--GREVRNPLQEFFEADRSPDDDKPVVYGRGW 58 Query: 351 KAS 359 KAS Sbjct: 59 KAS 61 >XP_017438695.1 PREDICTED: 39S ribosomal protein L47, mitochondrial [Vigna angularis] KOM56455.1 hypothetical protein LR48_Vigan10g234700 [Vigna angularis] BAT79663.1 hypothetical protein VIGAN_02258000 [Vigna angularis var. angularis] Length = 142 Score = 58.2 bits (139), Expect = 3e-08 Identities = 31/63 (49%), Positives = 37/63 (58%) Frame = +3 Query: 171 MSMIRALGRTLFXXXXXXXXXXXXXXXXXMGRIAQNPLEEFFEVDRTMEAEKPVVYGRGW 350 M + R LGRTLF GR +NPL+EFFE DR+ + +KPVVYGRGW Sbjct: 1 MFLSRTLGRTLFAAAARSKRYATTAPAG--GREVRNPLQEFFEADRSPDDDKPVVYGRGW 58 Query: 351 KAS 359 KAS Sbjct: 59 KAS 61 >XP_009397507.1 PREDICTED: 39S ribosomal protein L47, mitochondrial [Musa acuminata subsp. malaccensis] Length = 145 Score = 58.2 bits (139), Expect = 3e-08 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 264 RIAQNPLEEFFEVDRTMEAEKPVVYGRGWKAS 359 R A NPLEEFFEVDR+ + EKPVVYGRGWKAS Sbjct: 33 RRAHNPLEEFFEVDRSTDEEKPVVYGRGWKAS 64 >XP_009118414.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Brassica rapa] XP_009118415.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Brassica rapa] Length = 146 Score = 58.2 bits (139), Expect = 3e-08 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +3 Query: 264 RIAQNPLEEFFEVDRTMEAEKPVVYGRGWKAS 359 R+A+NPLEEFFE DR+ + +KPVVYGRGWKAS Sbjct: 34 RVAKNPLEEFFEFDRSQDEDKPVVYGRGWKAS 65 >XP_007138200.1 hypothetical protein PHAVU_009G188900g [Phaseolus vulgaris] ESW10194.1 hypothetical protein PHAVU_009G188900g [Phaseolus vulgaris] Length = 142 Score = 57.8 bits (138), Expect = 4e-08 Identities = 31/63 (49%), Positives = 37/63 (58%) Frame = +3 Query: 171 MSMIRALGRTLFXXXXXXXXXXXXXXXXXMGRIAQNPLEEFFEVDRTMEAEKPVVYGRGW 350 M + R LGRTLF GR +NPL+EFFE DR+ + +KPVVYGRGW Sbjct: 1 MFLHRTLGRTLFAAAARSKQYATTAPAG--GREVRNPLQEFFEADRSPDDDKPVVYGRGW 58 Query: 351 KAS 359 KAS Sbjct: 59 KAS 61 >XP_006840519.1 PREDICTED: 39S ribosomal protein L47, mitochondrial [Amborella trichopoda] XP_011621917.1 PREDICTED: 39S ribosomal protein L47, mitochondrial [Amborella trichopoda] XP_011621918.1 PREDICTED: 39S ribosomal protein L47, mitochondrial [Amborella trichopoda] XP_011621919.1 PREDICTED: 39S ribosomal protein L47, mitochondrial [Amborella trichopoda] XP_011621920.1 PREDICTED: 39S ribosomal protein L47, mitochondrial [Amborella trichopoda] XP_011621921.1 PREDICTED: 39S ribosomal protein L47, mitochondrial [Amborella trichopoda] ERN02194.1 hypothetical protein AMTR_s00045p00206320 [Amborella trichopoda] Length = 139 Score = 57.4 bits (137), Expect = 5e-08 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +3 Query: 264 RIAQNPLEEFFEVDRTMEAEKPVVYGRGWKAS 359 R+ NPLEEFFEVDR+ + +KPVVYGRGWKAS Sbjct: 27 RVTHNPLEEFFEVDRSPDEDKPVVYGRGWKAS 58 >XP_013641145.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Brassica napus] Length = 144 Score = 57.4 bits (137), Expect = 5e-08 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +3 Query: 264 RIAQNPLEEFFEVDRTMEAEKPVVYGRGWKAS 359 +IA+NPLEEFFE DR+ + +KPVVYGRGWKAS Sbjct: 32 KIAKNPLEEFFEFDRSQDEDKPVVYGRGWKAS 63 >XP_013584052.1 PREDICTED: 39S ribosomal protein L47, mitochondrial [Brassica oleracea var. oleracea] Length = 144 Score = 57.4 bits (137), Expect = 5e-08 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +3 Query: 264 RIAQNPLEEFFEVDRTMEAEKPVVYGRGWKAS 359 +IA+NPLEEFFE DR+ + +KPVVYGRGWKAS Sbjct: 32 KIAKNPLEEFFEFDRSQDEDKPVVYGRGWKAS 63 >XP_009148030.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Brassica rapa] Length = 144 Score = 57.4 bits (137), Expect = 5e-08 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +3 Query: 264 RIAQNPLEEFFEVDRTMEAEKPVVYGRGWKAS 359 +IA+NPLEEFFE DR+ + +KPVVYGRGWKAS Sbjct: 32 KIAKNPLEEFFEFDRSQDEDKPVVYGRGWKAS 63 >XP_013708376.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Brassica napus] CDX95120.1 BnaC05g05510D [Brassica napus] Length = 144 Score = 57.4 bits (137), Expect = 5e-08 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +3 Query: 264 RIAQNPLEEFFEVDRTMEAEKPVVYGRGWKAS 359 +IA+NPLEEFFE DR+ + +KPVVYGRGWKAS Sbjct: 32 KIAKNPLEEFFEFDRSQDEDKPVVYGRGWKAS 63 >XP_018465857.1 PREDICTED: 39S ribosomal protein L47, mitochondrial [Raphanus sativus] XP_018465917.1 PREDICTED: 39S ribosomal protein L47, mitochondrial [Raphanus sativus] Length = 146 Score = 57.4 bits (137), Expect = 6e-08 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +3 Query: 264 RIAQNPLEEFFEVDRTMEAEKPVVYGRGWKAS 359 +IA+NPLEEFFE DR+ + +KPVVYGRGWKAS Sbjct: 34 KIAKNPLEEFFEFDRSQDEDKPVVYGRGWKAS 65 >CDX93615.1 BnaA06g04330D [Brassica napus] Length = 146 Score = 57.4 bits (137), Expect = 6e-08 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +3 Query: 264 RIAQNPLEEFFEVDRTMEAEKPVVYGRGWKAS 359 +IA+NPLEEFFE DR+ + +KPVVYGRGWKAS Sbjct: 34 KIAKNPLEEFFEFDRSQDEDKPVVYGRGWKAS 65