BLASTX nr result
ID: Lithospermum23_contig00010864
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00010864 (272 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019265217.1 PREDICTED: pre-mRNA-splicing factor 38B isoform X... 63 1e-10 XP_018626704.1 PREDICTED: pre-mRNA-splicing factor 38B isoform X... 63 2e-10 XP_018626703.1 PREDICTED: pre-mRNA-splicing factor 38B isoform X... 63 3e-10 XP_019068855.1 PREDICTED: pre-mRNA-splicing factor 38B isoform X... 62 3e-10 XP_019265210.1 PREDICTED: pre-mRNA-splicing factor 38B isoform X... 63 3e-10 XP_018626702.1 PREDICTED: pre-mRNA-splicing factor 38B isoform X... 63 3e-10 XP_019068854.1 PREDICTED: pre-mRNA-splicing factor 38B isoform X... 62 4e-10 XP_019068853.1 PREDICTED: pre-mRNA-splicing factor 38B isoform X... 62 4e-10 CDP01678.1 unnamed protein product [Coffea canephora] 64 4e-10 XP_019068852.1 PREDICTED: pre-mRNA-splicing factor 38B isoform X... 62 6e-10 XP_016572047.1 PREDICTED: pre-mRNA-splicing factor 38B isoform X... 63 2e-09 XP_016500705.1 PREDICTED: pre-mRNA-splicing factor 38B-like [Nic... 63 2e-09 XP_009775042.1 PREDICTED: pre-mRNA-splicing factor 38B [Nicotian... 63 2e-09 XP_016486807.1 PREDICTED: pre-mRNA-splicing factor 38B-like [Nic... 63 2e-09 XP_019265191.1 PREDICTED: pre-mRNA-splicing factor 38B isoform X... 63 2e-09 XP_006346763.1 PREDICTED: pre-mRNA-splicing factor 38B [Solanum ... 62 3e-09 XP_015073632.1 PREDICTED: pre-mRNA-splicing factor 38B [Solanum ... 62 3e-09 XP_004236682.1 PREDICTED: pre-mRNA-splicing factor 38B isoform X... 62 3e-09 XP_011100064.1 PREDICTED: pre-mRNA-splicing factor 38B-like [Ses... 61 5e-09 XP_011085891.1 PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-splicing... 61 5e-09 >XP_019265217.1 PREDICTED: pre-mRNA-splicing factor 38B isoform X5 [Nicotiana attenuata] Length = 131 Score = 62.8 bits (151), Expect = 1e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +2 Query: 173 MAEVQTSGRPIDQCLEKVLCMNILSSEYFRDLL 271 MAE++TSGRPIDQ LEKVLCMNILSS+YFRDLL Sbjct: 1 MAEIKTSGRPIDQLLEKVLCMNILSSDYFRDLL 33 >XP_018626704.1 PREDICTED: pre-mRNA-splicing factor 38B isoform X6 [Nicotiana tomentosiformis] Length = 157 Score = 62.8 bits (151), Expect = 2e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +2 Query: 173 MAEVQTSGRPIDQCLEKVLCMNILSSEYFRDLL 271 MAE++TSGRPIDQ LEKVLCMNILSS+YFRDLL Sbjct: 1 MAEIKTSGRPIDQLLEKVLCMNILSSDYFRDLL 33 >XP_018626703.1 PREDICTED: pre-mRNA-splicing factor 38B isoform X5 [Nicotiana tomentosiformis] Length = 164 Score = 62.8 bits (151), Expect = 3e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +2 Query: 173 MAEVQTSGRPIDQCLEKVLCMNILSSEYFRDLL 271 MAE++TSGRPIDQ LEKVLCMNILSS+YFRDLL Sbjct: 1 MAEIKTSGRPIDQLLEKVLCMNILSSDYFRDLL 33 >XP_019068855.1 PREDICTED: pre-mRNA-splicing factor 38B isoform X6 [Solanum lycopersicum] Length = 131 Score = 62.0 bits (149), Expect = 3e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +2 Query: 173 MAEVQTSGRPIDQCLEKVLCMNILSSEYFRDLL 271 MAE++TSGRPIDQ LEKVLCMNILSS+YFRDLL Sbjct: 1 MAELKTSGRPIDQLLEKVLCMNILSSDYFRDLL 33 >XP_019265210.1 PREDICTED: pre-mRNA-splicing factor 38B isoform X4 [Nicotiana attenuata] Length = 174 Score = 62.8 bits (151), Expect = 3e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +2 Query: 173 MAEVQTSGRPIDQCLEKVLCMNILSSEYFRDLL 271 MAE++TSGRPIDQ LEKVLCMNILSS+YFRDLL Sbjct: 1 MAEIKTSGRPIDQLLEKVLCMNILSSDYFRDLL 33 >XP_018626702.1 PREDICTED: pre-mRNA-splicing factor 38B isoform X4 [Nicotiana tomentosiformis] Length = 174 Score = 62.8 bits (151), Expect = 3e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +2 Query: 173 MAEVQTSGRPIDQCLEKVLCMNILSSEYFRDLL 271 MAE++TSGRPIDQ LEKVLCMNILSS+YFRDLL Sbjct: 1 MAEIKTSGRPIDQLLEKVLCMNILSSDYFRDLL 33 >XP_019068854.1 PREDICTED: pre-mRNA-splicing factor 38B isoform X5 [Solanum lycopersicum] Length = 151 Score = 62.0 bits (149), Expect = 4e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +2 Query: 173 MAEVQTSGRPIDQCLEKVLCMNILSSEYFRDLL 271 MAE++TSGRPIDQ LEKVLCMNILSS+YFRDLL Sbjct: 1 MAELKTSGRPIDQLLEKVLCMNILSSDYFRDLL 33 >XP_019068853.1 PREDICTED: pre-mRNA-splicing factor 38B isoform X4 [Solanum lycopersicum] Length = 151 Score = 62.0 bits (149), Expect = 4e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +2 Query: 173 MAEVQTSGRPIDQCLEKVLCMNILSSEYFRDLL 271 MAE++TSGRPIDQ LEKVLCMNILSS+YFRDLL Sbjct: 1 MAELKTSGRPIDQLLEKVLCMNILSSDYFRDLL 33 >CDP01678.1 unnamed protein product [Coffea canephora] Length = 406 Score = 64.3 bits (155), Expect = 4e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 173 MAEVQTSGRPIDQCLEKVLCMNILSSEYFRDLL 271 MAE+QTSGRPIDQ LEKVLCMNILSS+YFRDLL Sbjct: 1 MAEIQTSGRPIDQLLEKVLCMNILSSDYFRDLL 33 >XP_019068852.1 PREDICTED: pre-mRNA-splicing factor 38B isoform X3 [Solanum lycopersicum] Length = 174 Score = 62.0 bits (149), Expect = 6e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +2 Query: 173 MAEVQTSGRPIDQCLEKVLCMNILSSEYFRDLL 271 MAE++TSGRPIDQ LEKVLCMNILSS+YFRDLL Sbjct: 1 MAELKTSGRPIDQLLEKVLCMNILSSDYFRDLL 33 >XP_016572047.1 PREDICTED: pre-mRNA-splicing factor 38B isoform X1 [Capsicum annuum] Length = 433 Score = 62.8 bits (151), Expect = 2e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +2 Query: 173 MAEVQTSGRPIDQCLEKVLCMNILSSEYFRDLL 271 MAE++TSGRPIDQ LEKVLCMNILSS+YFRDLL Sbjct: 1 MAEIKTSGRPIDQLLEKVLCMNILSSDYFRDLL 33 >XP_016500705.1 PREDICTED: pre-mRNA-splicing factor 38B-like [Nicotiana tabacum] Length = 435 Score = 62.8 bits (151), Expect = 2e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +2 Query: 173 MAEVQTSGRPIDQCLEKVLCMNILSSEYFRDLL 271 MAE++TSGRPIDQ LEKVLCMNILSS+YFRDLL Sbjct: 1 MAEIKTSGRPIDQLLEKVLCMNILSSDYFRDLL 33 >XP_009775042.1 PREDICTED: pre-mRNA-splicing factor 38B [Nicotiana sylvestris] Length = 435 Score = 62.8 bits (151), Expect = 2e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +2 Query: 173 MAEVQTSGRPIDQCLEKVLCMNILSSEYFRDLL 271 MAE++TSGRPIDQ LEKVLCMNILSS+YFRDLL Sbjct: 1 MAEIKTSGRPIDQLLEKVLCMNILSSDYFRDLL 33 >XP_016486807.1 PREDICTED: pre-mRNA-splicing factor 38B-like [Nicotiana tabacum] XP_018626699.1 PREDICTED: pre-mRNA-splicing factor 38B isoform X1 [Nicotiana tomentosiformis] Length = 435 Score = 62.8 bits (151), Expect = 2e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +2 Query: 173 MAEVQTSGRPIDQCLEKVLCMNILSSEYFRDLL 271 MAE++TSGRPIDQ LEKVLCMNILSS+YFRDLL Sbjct: 1 MAEIKTSGRPIDQLLEKVLCMNILSSDYFRDLL 33 >XP_019265191.1 PREDICTED: pre-mRNA-splicing factor 38B isoform X1 [Nicotiana attenuata] XP_019265196.1 PREDICTED: pre-mRNA-splicing factor 38B isoform X1 [Nicotiana attenuata] Length = 439 Score = 62.8 bits (151), Expect = 2e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +2 Query: 173 MAEVQTSGRPIDQCLEKVLCMNILSSEYFRDLL 271 MAE++TSGRPIDQ LEKVLCMNILSS+YFRDLL Sbjct: 1 MAEIKTSGRPIDQLLEKVLCMNILSSDYFRDLL 33 >XP_006346763.1 PREDICTED: pre-mRNA-splicing factor 38B [Solanum tuberosum] Length = 430 Score = 62.0 bits (149), Expect = 3e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +2 Query: 173 MAEVQTSGRPIDQCLEKVLCMNILSSEYFRDLL 271 MAE++TSGRPIDQ LEKVLCMNILSS+YFRDLL Sbjct: 1 MAELKTSGRPIDQLLEKVLCMNILSSDYFRDLL 33 >XP_015073632.1 PREDICTED: pre-mRNA-splicing factor 38B [Solanum pennellii] Length = 434 Score = 62.0 bits (149), Expect = 3e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +2 Query: 173 MAEVQTSGRPIDQCLEKVLCMNILSSEYFRDLL 271 MAE++TSGRPIDQ LEKVLCMNILSS+YFRDLL Sbjct: 1 MAELKTSGRPIDQLLEKVLCMNILSSDYFRDLL 33 >XP_004236682.1 PREDICTED: pre-mRNA-splicing factor 38B isoform X1 [Solanum lycopersicum] Length = 444 Score = 62.0 bits (149), Expect = 3e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +2 Query: 173 MAEVQTSGRPIDQCLEKVLCMNILSSEYFRDLL 271 MAE++TSGRPIDQ LEKVLCMNILSS+YFRDLL Sbjct: 1 MAELKTSGRPIDQLLEKVLCMNILSSDYFRDLL 33 >XP_011100064.1 PREDICTED: pre-mRNA-splicing factor 38B-like [Sesamum indicum] Length = 415 Score = 61.2 bits (147), Expect = 5e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +2 Query: 173 MAEVQTSGRPIDQCLEKVLCMNILSSEYFRDLL 271 MAE+++SGRPIDQ LEKVLCMNILSS+YFRDLL Sbjct: 1 MAEIKSSGRPIDQLLEKVLCMNILSSDYFRDLL 33 >XP_011085891.1 PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-splicing factor 38B-like [Sesamum indicum] Length = 435 Score = 61.2 bits (147), Expect = 5e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +2 Query: 173 MAEVQTSGRPIDQCLEKVLCMNILSSEYFRDLL 271 MAE+++SGRPIDQ LEKVLCMNILSS+YFRDLL Sbjct: 1 MAEIKSSGRPIDQLLEKVLCMNILSSDYFRDLL 33