BLASTX nr result
ID: Lithospermum23_contig00010663
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00010663 (632 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU29955.1 hypothetical protein TSUD_360700 [Trifolium subterran... 40 5e-06 >GAU29955.1 hypothetical protein TSUD_360700 [Trifolium subterraneum] Length = 1514 Score = 40.4 bits (93), Expect(3) = 5e-06 Identities = 17/37 (45%), Positives = 24/37 (64%) Frame = +3 Query: 309 TFICP*LLVPKPNGI*RICTDFTSINKTNSKDCYPFP 419 T++ +LV KPNG R+C D+T +N+ KD YP P Sbjct: 553 TWLSNVVLVKKPNGKWRMCVDYTDLNRACPKDAYPLP 589 Score = 31.6 bits (70), Expect(3) = 5e-06 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = +1 Query: 448 GYKVLDFLDGFRGYHQILMAE 510 G+K+L F+D + GY+QI MAE Sbjct: 600 GFKLLSFMDAYSGYNQIKMAE 620 Score = 25.0 bits (53), Expect(3) = 5e-06 Identities = 9/13 (69%), Positives = 13/13 (100%) Frame = +2 Query: 413 LPNIEKLIDSSAG 451 LPNI+KL+D+S+G Sbjct: 588 LPNIDKLVDNSSG 600