BLASTX nr result
ID: Lithospermum23_contig00010203
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00010203 (486 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015899961.1 PREDICTED: 60S ribosomal protein L29-2-like [Zizi... 124 2e-34 OIW17679.1 hypothetical protein TanjilG_29029 [Lupinus angustifo... 119 1e-32 XP_015937248.1 PREDICTED: 60S ribosomal protein L29-1-like [Arac... 119 2e-32 KJB72799.1 hypothetical protein B456_011G198800 [Gossypium raimo... 121 2e-32 XP_006419418.1 hypothetical protein CICLE_v10006499mg, partial [... 119 2e-32 XP_017646948.1 PREDICTED: 60S ribosomal protein L29-1-like [Goss... 118 3e-32 KVH99849.1 Ribosomal protein L29e [Cynara cardunculus var. scoly... 117 6e-32 XP_004499658.1 PREDICTED: 60S ribosomal protein L29-1-like [Cice... 117 6e-32 XP_012084042.1 PREDICTED: 60S ribosomal protein L29-1 [Jatropha ... 117 8e-32 XP_007227529.1 hypothetical protein PRUPE_ppa014537mg [Prunus pe... 117 8e-32 XP_010094315.1 60S ribosomal protein L29-1 [Morus notabilis] EXB... 117 1e-31 XP_007035751.1 PREDICTED: 60S ribosomal protein L29-1 [Theobroma... 117 1e-31 XP_006488862.1 PREDICTED: 60S ribosomal protein L29-1-like [Citr... 116 2e-31 XP_014499184.1 PREDICTED: 60S ribosomal protein L29-1-like [Vign... 116 2e-31 XP_017429849.1 PREDICTED: 60S ribosomal protein L29-1-like [Vign... 116 2e-31 XP_017409783.1 PREDICTED: 60S ribosomal protein L29-1 [Vigna ang... 116 2e-31 XP_009789604.1 PREDICTED: 60S ribosomal protein L29-1-like [Nico... 116 2e-31 XP_007138981.1 hypothetical protein PHAVU_009G254800g [Phaseolus... 116 2e-31 OMO58425.1 Ribosomal protein L29e [Corchorus olitorius] 116 2e-31 XP_012487452.1 PREDICTED: 60S ribosomal protein L29-1-like [Goss... 116 2e-31 >XP_015899961.1 PREDICTED: 60S ribosomal protein L29-2-like [Ziziphus jujuba] Length = 60 Score = 124 bits (310), Expect = 2e-34 Identities = 56/60 (93%), Positives = 57/60 (95%) Frame = -2 Query: 404 MAKSKNHTAHNQSYKAHKNGIKKPRRHRHTSTKGMDPKFLRNQRYARKHNNSQNEGAAEE 225 MAKSKNHTAHNQSYKAHKNGIKKPR+HRHTSTKGMDPKFLRNQRYARKHNN QNEG EE Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNKQNEGTEEE 60 >OIW17679.1 hypothetical protein TanjilG_29029 [Lupinus angustifolius] Length = 61 Score = 119 bits (298), Expect = 1e-32 Identities = 54/60 (90%), Positives = 55/60 (91%) Frame = -2 Query: 404 MAKSKNHTAHNQSYKAHKNGIKKPRRHRHTSTKGMDPKFLRNQRYARKHNNSQNEGAAEE 225 MAKSKNHTAHNQSYKAHKNGIKKP+RHRHTSTKGMDPKFLRNQRYARKHNN E A EE Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNNKNGESATEE 60 >XP_015937248.1 PREDICTED: 60S ribosomal protein L29-1-like [Arachis duranensis] XP_015937256.1 PREDICTED: 60S ribosomal protein L29-1-like [Arachis duranensis] XP_016198015.1 PREDICTED: 60S ribosomal protein L29-1-like [Arachis ipaensis] XP_016198024.1 PREDICTED: 60S ribosomal protein L29-1-like [Arachis ipaensis] APT68166.1 60S ribosomal protein L29-1 [Arachis hypogaea] APT68167.1 60S ribosomal protein L29-1 [Arachis hypogaea] Length = 61 Score = 119 bits (297), Expect = 2e-32 Identities = 53/60 (88%), Positives = 57/60 (95%) Frame = -2 Query: 404 MAKSKNHTAHNQSYKAHKNGIKKPRRHRHTSTKGMDPKFLRNQRYARKHNNSQNEGAAEE 225 MAKSKNHTAHNQSYKAHKNGIKKP++HRHTSTKGMDPKFLRNQRYARKHN +EG+AEE Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKKSDEGSAEE 60 >KJB72799.1 hypothetical protein B456_011G198800 [Gossypium raimondii] Length = 146 Score = 121 bits (304), Expect = 2e-32 Identities = 55/65 (84%), Positives = 58/65 (89%) Frame = -2 Query: 419 FTSAEMAKSKNHTAHNQSYKAHKNGIKKPRRHRHTSTKGMDPKFLRNQRYARKHNNSQNE 240 F ++EMAKSKNHTAHNQSYKAHKNGIKKP+RHRHTSTKGMDPKFLRNQRYARKHN E Sbjct: 81 FLASEMAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKSGE 140 Query: 239 GAAEE 225 A EE Sbjct: 141 SATEE 145 >XP_006419418.1 hypothetical protein CICLE_v10006499mg, partial [Citrus clementina] ESR32658.1 hypothetical protein CICLE_v10006499mg, partial [Citrus clementina] Length = 88 Score = 119 bits (299), Expect = 2e-32 Identities = 55/65 (84%), Positives = 57/65 (87%) Frame = -2 Query: 419 FTSAEMAKSKNHTAHNQSYKAHKNGIKKPRRHRHTSTKGMDPKFLRNQRYARKHNNSQNE 240 F EMAKSKNHTAHNQSYKAHKNGIKKP++HRHTSTKGMDPKFLRNQRYARKHN E Sbjct: 24 FPENEMAKSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQGGE 83 Query: 239 GAAEE 225 AAEE Sbjct: 84 SAAEE 88 >XP_017646948.1 PREDICTED: 60S ribosomal protein L29-1-like [Gossypium arboreum] XP_017646949.1 PREDICTED: 60S ribosomal protein L29-1-like [Gossypium arboreum] Length = 61 Score = 118 bits (296), Expect = 3e-32 Identities = 54/60 (90%), Positives = 55/60 (91%) Frame = -2 Query: 404 MAKSKNHTAHNQSYKAHKNGIKKPRRHRHTSTKGMDPKFLRNQRYARKHNNSQNEGAAEE 225 MAKSKNHTAHNQSYKAHKNGIKKP+RHRHTSTKGMDPKFLRNQRYARKHN E AAEE Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKNGESAAEE 60 >KVH99849.1 Ribosomal protein L29e [Cynara cardunculus var. scolymus] Length = 60 Score = 117 bits (294), Expect = 6e-32 Identities = 53/60 (88%), Positives = 56/60 (93%) Frame = -2 Query: 404 MAKSKNHTAHNQSYKAHKNGIKKPRRHRHTSTKGMDPKFLRNQRYARKHNNSQNEGAAEE 225 MAKSKNHTAHNQS+KAH+NGIKKPR+HRHTSTKGMDPKFLRNQRYARKHNN E AAEE Sbjct: 1 MAKSKNHTAHNQSHKAHRNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNQSGESAAEE 60 >XP_004499658.1 PREDICTED: 60S ribosomal protein L29-1-like [Cicer arietinum] XP_012571028.1 PREDICTED: 60S ribosomal protein L29-1-like isoform X4 [Cicer arietinum] Length = 61 Score = 117 bits (294), Expect = 6e-32 Identities = 54/60 (90%), Positives = 55/60 (91%) Frame = -2 Query: 404 MAKSKNHTAHNQSYKAHKNGIKKPRRHRHTSTKGMDPKFLRNQRYARKHNNSQNEGAAEE 225 MAKSKNHTAHNQSYKAHKNGIKKP+RHRHTSTKGMDPKFLRNQRYARKHNN E A EE Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNNKNGEIATEE 60 >XP_012084042.1 PREDICTED: 60S ribosomal protein L29-1 [Jatropha curcas] XP_012084043.1 PREDICTED: 60S ribosomal protein L29-1 [Jatropha curcas] KDP27893.1 hypothetical protein JCGZ_18973 [Jatropha curcas] Length = 61 Score = 117 bits (293), Expect = 8e-32 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = -2 Query: 404 MAKSKNHTAHNQSYKAHKNGIKKPRRHRHTSTKGMDPKFLRNQRYARKHNNSQNEGAAEE 225 MAKSKNHTAHNQSYKAHKNGIKKP+RHRHTSTKGMDPKFLRNQRYARKHNN + A+E+ Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQ 60 >XP_007227529.1 hypothetical protein PRUPE_ppa014537mg [Prunus persica] XP_007227530.1 hypothetical protein PRUPE_ppa014537mg [Prunus persica] XP_008223313.1 PREDICTED: 60S ribosomal protein L29-1-like [Prunus mume] ONI28089.1 hypothetical protein PRUPE_1G122500 [Prunus persica] ONI28090.1 hypothetical protein PRUPE_1G122500 [Prunus persica] Length = 61 Score = 117 bits (293), Expect = 8e-32 Identities = 53/60 (88%), Positives = 57/60 (95%) Frame = -2 Query: 404 MAKSKNHTAHNQSYKAHKNGIKKPRRHRHTSTKGMDPKFLRNQRYARKHNNSQNEGAAEE 225 MAKSKNHTAHNQS KAH+NGIKKP+RHRHTSTKGMDPKFLRNQRYARKHNN++NE A EE Sbjct: 1 MAKSKNHTAHNQSRKAHRNGIKKPQRHRHTSTKGMDPKFLRNQRYARKHNNTKNESATEE 60 >XP_010094315.1 60S ribosomal protein L29-1 [Morus notabilis] EXB55735.1 60S ribosomal protein L29-1 [Morus notabilis] Length = 61 Score = 117 bits (292), Expect = 1e-31 Identities = 51/60 (85%), Positives = 57/60 (95%) Frame = -2 Query: 404 MAKSKNHTAHNQSYKAHKNGIKKPRRHRHTSTKGMDPKFLRNQRYARKHNNSQNEGAAEE 225 MAKSKNHTAHNQS+KAHKNGIKKPR+HRHTSTKGMDPKFLRNQRYARKHNN +N+ +E+ Sbjct: 1 MAKSKNHTAHNQSFKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNQKNQSGSEQ 60 >XP_007035751.1 PREDICTED: 60S ribosomal protein L29-1 [Theobroma cacao] XP_012455658.1 PREDICTED: 60S ribosomal protein L29-1 [Gossypium raimondii] XP_012455659.1 PREDICTED: 60S ribosomal protein L29-1 [Gossypium raimondii] XP_012455660.1 PREDICTED: 60S ribosomal protein L29-1 [Gossypium raimondii] XP_016677307.1 PREDICTED: 60S ribosomal protein L29-1 [Gossypium hirsutum] XP_016677308.1 PREDICTED: 60S ribosomal protein L29-1 [Gossypium hirsutum] XP_017646946.1 PREDICTED: 60S ribosomal protein L29-1 [Gossypium arboreum] XP_017646947.1 PREDICTED: 60S ribosomal protein L29-1 [Gossypium arboreum] EOY06677.1 Ribosomal L29e protein family [Theobroma cacao] KHG07587.1 60S ribosomal L29-1 -like protein [Gossypium arboreum] Length = 61 Score = 117 bits (292), Expect = 1e-31 Identities = 53/60 (88%), Positives = 54/60 (90%) Frame = -2 Query: 404 MAKSKNHTAHNQSYKAHKNGIKKPRRHRHTSTKGMDPKFLRNQRYARKHNNSQNEGAAEE 225 MAKSKNHTAHNQSYKAHKNGIKKP+RHRHTSTKGMDPKFLRNQRYARKHN E A EE Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKSGESATEE 60 >XP_006488862.1 PREDICTED: 60S ribosomal protein L29-1-like [Citrus sinensis] Length = 60 Score = 116 bits (291), Expect = 2e-31 Identities = 53/60 (88%), Positives = 55/60 (91%) Frame = -2 Query: 404 MAKSKNHTAHNQSYKAHKNGIKKPRRHRHTSTKGMDPKFLRNQRYARKHNNSQNEGAAEE 225 MAKSKNHTAHNQSYKAHKNGIKKP++HRHTSTKGMDPKFLRNQRYARKHN E AAEE Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQGGESAAEE 60 >XP_014499184.1 PREDICTED: 60S ribosomal protein L29-1-like [Vigna radiata var. radiata] Length = 61 Score = 116 bits (291), Expect = 2e-31 Identities = 53/60 (88%), Positives = 55/60 (91%) Frame = -2 Query: 404 MAKSKNHTAHNQSYKAHKNGIKKPRRHRHTSTKGMDPKFLRNQRYARKHNNSQNEGAAEE 225 MAKSKNHTAHNQSYKAHKNGIKKP+RHRHTSTKGMDPKFLRNQRYARKHN E A+EE Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKNGETASEE 60 >XP_017429849.1 PREDICTED: 60S ribosomal protein L29-1-like [Vigna angularis] KOM33445.1 hypothetical protein LR48_Vigan01g300100 [Vigna angularis] Length = 61 Score = 116 bits (291), Expect = 2e-31 Identities = 53/60 (88%), Positives = 55/60 (91%) Frame = -2 Query: 404 MAKSKNHTAHNQSYKAHKNGIKKPRRHRHTSTKGMDPKFLRNQRYARKHNNSQNEGAAEE 225 MAKSKNHTAHNQSYKAHKNGIKKP+RHRHTSTKGMDPKFLRNQRYARKHN E A+EE Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKQSGETASEE 60 >XP_017409783.1 PREDICTED: 60S ribosomal protein L29-1 [Vigna angularis] KOM29161.1 hypothetical protein LR48_Vigan635s008600 [Vigna angularis] Length = 61 Score = 116 bits (291), Expect = 2e-31 Identities = 53/60 (88%), Positives = 55/60 (91%) Frame = -2 Query: 404 MAKSKNHTAHNQSYKAHKNGIKKPRRHRHTSTKGMDPKFLRNQRYARKHNNSQNEGAAEE 225 MAKSKNHTAHNQSYKAHKNGIKKP+RHRHTSTKGMDPKFLRNQRYARKHN E A+EE Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKDGETASEE 60 >XP_009789604.1 PREDICTED: 60S ribosomal protein L29-1-like [Nicotiana sylvestris] XP_009789605.1 PREDICTED: 60S ribosomal protein L29-1-like [Nicotiana sylvestris] XP_016454572.1 PREDICTED: 60S ribosomal protein L29-1-like [Nicotiana tabacum] XP_016454573.1 PREDICTED: 60S ribosomal protein L29-1-like [Nicotiana tabacum] XP_019241343.1 PREDICTED: 60S ribosomal protein L29-1-like [Nicotiana attenuata] Length = 61 Score = 116 bits (291), Expect = 2e-31 Identities = 51/60 (85%), Positives = 59/60 (98%) Frame = -2 Query: 404 MAKSKNHTAHNQSYKAHKNGIKKPRRHRHTSTKGMDPKFLRNQRYARKHNNSQNEGAAEE 225 MAKSKNHTAHNQSYKAH+NGIKKPR+HRH+STKGMDPKFLRNQRYARKHNN+++ G+A+E Sbjct: 1 MAKSKNHTAHNQSYKAHRNGIKKPRKHRHSSTKGMDPKFLRNQRYARKHNNNKSVGSADE 60 >XP_007138981.1 hypothetical protein PHAVU_009G254800g [Phaseolus vulgaris] XP_007154358.1 hypothetical protein PHAVU_003G112200g [Phaseolus vulgaris] XP_014508057.1 PREDICTED: 60S ribosomal protein L29-1 [Vigna radiata var. radiata] ESW10975.1 hypothetical protein PHAVU_009G254800g [Phaseolus vulgaris] ESW26352.1 hypothetical protein PHAVU_003G112200g [Phaseolus vulgaris] Length = 61 Score = 116 bits (291), Expect = 2e-31 Identities = 53/60 (88%), Positives = 55/60 (91%) Frame = -2 Query: 404 MAKSKNHTAHNQSYKAHKNGIKKPRRHRHTSTKGMDPKFLRNQRYARKHNNSQNEGAAEE 225 MAKSKNHTAHNQSYKAHKNGIKKP+RHRHTSTKGMDPKFLRNQRYARKHN E A+EE Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKSGETASEE 60 >OMO58425.1 Ribosomal protein L29e [Corchorus olitorius] Length = 60 Score = 116 bits (290), Expect = 2e-31 Identities = 53/60 (88%), Positives = 54/60 (90%) Frame = -2 Query: 404 MAKSKNHTAHNQSYKAHKNGIKKPRRHRHTSTKGMDPKFLRNQRYARKHNNSQNEGAAEE 225 MAKSKNHTAHNQSYKAHKNGIKKP+RHRHTSTKGMDPKFLRNQRYARKHN E A EE Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKSGESADEE 60 >XP_012487452.1 PREDICTED: 60S ribosomal protein L29-1-like [Gossypium raimondii] KJB38533.1 hypothetical protein B456_006G259400 [Gossypium raimondii] KJB38534.1 hypothetical protein B456_006G259400 [Gossypium raimondii] Length = 61 Score = 116 bits (290), Expect = 2e-31 Identities = 53/60 (88%), Positives = 54/60 (90%) Frame = -2 Query: 404 MAKSKNHTAHNQSYKAHKNGIKKPRRHRHTSTKGMDPKFLRNQRYARKHNNSQNEGAAEE 225 MAKSKNHTAHNQSYKAHKNGIKKP+RHRHTSTKGMDPKFLRNQRYARKHN E A EE Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKNGESANEE 60