BLASTX nr result
ID: Lithospermum23_contig00010124
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00010124 (1133 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY82025.1 hypothetical protein ACMD2_01613, partial [Ananas com... 55 3e-06 KNA13797.1 hypothetical protein SOVF_113530 [Spinacia oleracea] 54 5e-06 >OAY82025.1 hypothetical protein ACMD2_01613, partial [Ananas comosus] Length = 93 Score = 55.5 bits (132), Expect = 3e-06 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = -2 Query: 967 FIIFGFMSFPLFVYAAIVSKFLPESSNPVVPAIQRDRYISLL 842 F+ FG +SF +F YAAI+SKFLP NP++ AIQ DRY LL Sbjct: 27 FVAFGIVSFLVFFYAAIISKFLPPYQNPILAAIQNDRYYCLL 68 >KNA13797.1 hypothetical protein SOVF_113530 [Spinacia oleracea] Length = 81 Score = 54.3 bits (129), Expect = 5e-06 Identities = 25/44 (56%), Positives = 30/44 (68%) Frame = -2 Query: 973 IFFIIFGFMSFPLFVYAAIVSKFLPESSNPVVPAIQRDRYISLL 842 + F+ FG SF F YAA+VSK LP S NP++ AIQRDRY L Sbjct: 13 VMFLSFGLTSFGAFFYAAVVSKLLPLSDNPLISAIQRDRYYCFL 56