BLASTX nr result
ID: Lithospermum23_contig00009963
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00009963 (221 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ACF35280.1 cytochrome P450 reductase-like protein [Nothapodytes ... 60 7e-09 CBX24555.1 NADPH:cytochrome P450 reductase [Salvia miltiorrhiza] 55 3e-07 XP_012857359.1 PREDICTED: NADPH--cytochrome P450 reductase-like ... 54 8e-07 KZV33968.1 hypothetical protein F511_04193 [Dorcoceras hygrometr... 52 4e-06 XP_011069915.1 PREDICTED: NADPH--cytochrome P450 reductase-like ... 52 5e-06 XP_011079296.1 PREDICTED: NADPH--cytochrome P450 reductase-like ... 52 7e-06 ALO61908.1 NADPH cytochrome P450 oxidoreductase [Apium graveolens] 51 1e-05 AIG15452.1 NADPH-cytochrome P450 reductase 2 [Azadirachta indica] 51 1e-05 >ACF35280.1 cytochrome P450 reductase-like protein [Nothapodytes nimmoniana] Length = 709 Score = 60.1 bits (144), Expect = 7e-09 Identities = 27/42 (64%), Positives = 30/42 (71%) Frame = +3 Query: 96 VWFHDQTEGSITSNGSFKVNGHTVYDARHPCSVYVAVKKELH 221 V FHDQ +GS NG K NGH V+DA+HPC VAVKKELH Sbjct: 280 VVFHDQPDGSPVENGFSKANGHAVFDAQHPCRADVAVKKELH 321 >CBX24555.1 NADPH:cytochrome P450 reductase [Salvia miltiorrhiza] Length = 705 Score = 55.5 bits (132), Expect = 3e-07 Identities = 26/44 (59%), Positives = 32/44 (72%), Gaps = 2/44 (4%) Frame = +3 Query: 96 VWFHDQTEGSITSNGSFK--VNGHTVYDARHPCSVYVAVKKELH 221 V HDQT+G IT NGS NG+T+YDA+HPC VAV++ELH Sbjct: 274 VVLHDQTDGLITENGSPNGHANGNTIYDAQHPCRANVAVRRELH 317 >XP_012857359.1 PREDICTED: NADPH--cytochrome P450 reductase-like [Erythranthe guttata] EYU20907.1 hypothetical protein MIMGU_mgv1a002097mg [Erythranthe guttata] Length = 715 Score = 54.3 bits (129), Expect = 8e-07 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 2/44 (4%) Frame = +3 Query: 96 VWFHDQTEGSITSNGSFK--VNGHTVYDARHPCSVYVAVKKELH 221 V FHDQ++ SI N S NG+TVYDA+HPC VAVKKELH Sbjct: 284 VVFHDQSDESILENSSANGHANGNTVYDAQHPCRANVAVKKELH 327 >KZV33968.1 hypothetical protein F511_04193 [Dorcoceras hygrometricum] Length = 701 Score = 52.4 bits (124), Expect = 4e-06 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = +3 Query: 96 VWFHDQTEGSITSNGSFKVNGHTVYDARHPCSVYVAVKKELH 221 V FH+Q +GS T +GS NG+T YDA+HPC V VAV+ ELH Sbjct: 274 VVFHEQADGSATEDGS--TNGNTTYDAQHPCIVNVAVRIELH 313 >XP_011069915.1 PREDICTED: NADPH--cytochrome P450 reductase-like [Sesamum indicum] Length = 712 Score = 52.0 bits (123), Expect = 5e-06 Identities = 26/44 (59%), Positives = 29/44 (65%), Gaps = 2/44 (4%) Frame = +3 Query: 96 VWFHDQTEGSITSNGSFK--VNGHTVYDARHPCSVYVAVKKELH 221 V F+DQ + SI S NGH VYDA+HPC V VAVKKELH Sbjct: 281 VVFYDQVDDSILDKSSANGHANGHAVYDAQHPCRVNVAVKKELH 324 >XP_011079296.1 PREDICTED: NADPH--cytochrome P450 reductase-like [Sesamum indicum] Length = 705 Score = 51.6 bits (122), Expect = 7e-06 Identities = 25/44 (56%), Positives = 31/44 (70%), Gaps = 2/44 (4%) Frame = +3 Query: 96 VWFHDQTEGSI--TSNGSFKVNGHTVYDARHPCSVYVAVKKELH 221 V FHDQ EGSI +S + NG+ +YDA+HPC VAV+KELH Sbjct: 274 VVFHDQAEGSILESSLANGHANGNAIYDAQHPCRANVAVRKELH 317 >ALO61908.1 NADPH cytochrome P450 oxidoreductase [Apium graveolens] Length = 710 Score = 51.2 bits (121), Expect = 1e-05 Identities = 22/42 (52%), Positives = 27/42 (64%) Frame = +3 Query: 96 VWFHDQTEGSITSNGSFKVNGHTVYDARHPCSVYVAVKKELH 221 V FHDQT+ S+ NGH YDA+HPC V+VK+ELH Sbjct: 281 VVFHDQTDSSLLDRTFSMSNGHATYDAQHPCRANVSVKRELH 322 >AIG15452.1 NADPH-cytochrome P450 reductase 2 [Azadirachta indica] Length = 715 Score = 51.2 bits (121), Expect = 1e-05 Identities = 23/42 (54%), Positives = 27/42 (64%) Frame = +3 Query: 96 VWFHDQTEGSITSNGSFKVNGHTVYDARHPCSVYVAVKKELH 221 V F+D + SI N NGH VYDA+HPC VAV+KELH Sbjct: 286 VVFYDSADASIGENNWSNANGHAVYDAQHPCRSNVAVRKELH 327