BLASTX nr result
ID: Lithospermum23_contig00009905
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00009905 (511 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABW97846.1 MYC, partial [Nicotiana tabacum] 53 9e-06 >ABW97846.1 MYC, partial [Nicotiana tabacum] Length = 154 Score = 53.1 bits (126), Expect = 9e-06 Identities = 33/61 (54%), Positives = 39/61 (63%), Gaps = 4/61 (6%) Frame = +2 Query: 212 GLSRYDSAPSSSLTSAVDSVIATNPNRDF--FSSHHNQNHLAPSRYFS--KTNGNNTNKH 379 GL+RY SAP + LT+AV+SVI N N DF SHH HL PSRYFS T+ N+ N Sbjct: 15 GLTRYGSAPGAFLTTAVESVIGAN-NHDFNLHGSHH--QHLGPSRYFSPNMTSSNSLNSE 71 Query: 380 S 382 S Sbjct: 72 S 72