BLASTX nr result
ID: Lithospermum23_contig00009526
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00009526 (236 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017244221.1 PREDICTED: UPF0057 membrane protein At2g24040-lik... 55 2e-08 XP_011079386.1 PREDICTED: UPF0057 membrane protein At2g24040-lik... 55 3e-08 CDP10252.1 unnamed protein product [Coffea canephora] 51 7e-07 >XP_017244221.1 PREDICTED: UPF0057 membrane protein At2g24040-like [Daucus carota subsp. sativus] Length = 70 Score = 55.1 bits (131), Expect = 2e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 234 LGYVPGIIYALYVILFVDRDMFRGDYQTLA 145 LGYVPGIIYALY IL VDRDM+RG+Y TLA Sbjct: 41 LGYVPGIIYALYAILCVDRDMYRGEYYTLA 70 >XP_011079386.1 PREDICTED: UPF0057 membrane protein At2g24040-like [Sesamum indicum] Length = 71 Score = 54.7 bits (130), Expect = 3e-08 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 234 LGYVPGIIYALYVILFVDRDMFRGDYQTLA 145 LGYVPGIIYALY I+F+DRD FRGDY LA Sbjct: 42 LGYVPGIIYALYAIVFIDRDRFRGDYYQLA 71 >CDP10252.1 unnamed protein product [Coffea canephora] Length = 72 Score = 51.2 bits (121), Expect = 7e-07 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = -3 Query: 234 LGYVPGIIYALYVILFVDRDMFRGDY 157 LGYVPGIIYALY ILF+DRDM RG+Y Sbjct: 42 LGYVPGIIYALYAILFIDRDMSRGEY 67