BLASTX nr result
ID: Lithospermum23_contig00008298
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00008298 (1510 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EYU46780.1 hypothetical protein MIMGU_mgv1a0058491mg, partial [E... 55 4e-06 >EYU46780.1 hypothetical protein MIMGU_mgv1a0058491mg, partial [Erythranthe guttata] Length = 103 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = -2 Query: 1137 MSLRSTERNNICRSKHKVAMDANEGRQRREDNMIKIRKN 1021 MSLR + R + RS++KVA+DA EGR+RREDNM++IRKN Sbjct: 1 MSLRPSARTEVRRSRYKVAVDAEEGRRRREDNMVEIRKN 39