BLASTX nr result
ID: Lithospermum23_contig00008250
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00008250 (817 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012462518.1 PREDICTED: phytosulfokines 2-like [Gossypium raim... 55 1e-06 XP_017619019.1 PREDICTED: phytosulfokines-like [Gossypium arboreum] 55 2e-06 BAC53658.1 preprophytosulfokine [Zinnia violacea] 54 3e-06 KFK28454.1 hypothetical protein AALP_AA8G516400 [Arabis alpina] 54 4e-06 XP_018808728.1 PREDICTED: phytosulfokines-like [Juglans regia] 54 4e-06 XP_002285430.1 PREDICTED: phytosulfokines 3 [Vitis vinifera] CBI... 54 4e-06 >XP_012462518.1 PREDICTED: phytosulfokines 2-like [Gossypium raimondii] KJB79471.1 hypothetical protein B456_013G051800 [Gossypium raimondii] Length = 93 Score = 55.5 bits (132), Expect = 1e-06 Identities = 29/51 (56%), Positives = 36/51 (70%) Frame = +3 Query: 333 QEHKGENIGVRNEVVGERRLCEGVVDDDECLMMRRTLVAHLDYIYTQKEKP 485 Q H GE G ++ V CEG+V+++ECLM RRTL AH+DYIYTQK KP Sbjct: 46 QIHLGE--GEADQKVELEDSCEGIVEEEECLM-RRTLAAHIDYIYTQKTKP 93 >XP_017619019.1 PREDICTED: phytosulfokines-like [Gossypium arboreum] Length = 93 Score = 55.1 bits (131), Expect = 2e-06 Identities = 29/51 (56%), Positives = 36/51 (70%) Frame = +3 Query: 333 QEHKGENIGVRNEVVGERRLCEGVVDDDECLMMRRTLVAHLDYIYTQKEKP 485 Q H GE G ++ V CEG+V+++ECLM RRTL AH+DYIYTQK KP Sbjct: 46 QVHLGE--GEADQKVELDDSCEGIVEEEECLM-RRTLAAHIDYIYTQKTKP 93 >BAC53658.1 preprophytosulfokine [Zinnia violacea] Length = 75 Score = 53.9 bits (128), Expect = 3e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +3 Query: 393 CEGVVDDDECLMMRRTLVAHLDYIYTQKEKP 485 CEG + +DECLM RRTLVAHLDYIYTQK+ P Sbjct: 46 CEGTISEDECLM-RRTLVAHLDYIYTQKKNP 75 >KFK28454.1 hypothetical protein AALP_AA8G516400 [Arabis alpina] Length = 78 Score = 53.9 bits (128), Expect = 4e-06 Identities = 24/44 (54%), Positives = 32/44 (72%) Frame = +3 Query: 354 IGVRNEVVGERRLCEGVVDDDECLMMRRTLVAHLDYIYTQKEKP 485 I V+ +G+ CEGVV ++EC+++RRTLVAH DYIYTQ P Sbjct: 36 ISVKKSELGDEN-CEGVVGEEECVLIRRTLVAHTDYIYTQDHNP 78 >XP_018808728.1 PREDICTED: phytosulfokines-like [Juglans regia] Length = 80 Score = 53.9 bits (128), Expect = 4e-06 Identities = 28/43 (65%), Positives = 30/43 (69%) Frame = +3 Query: 357 GVRNEVVGERRLCEGVVDDDECLMMRRTLVAHLDYIYTQKEKP 485 GV+ E V CEGV +ECLM RRTL AHLDYIYTQK KP Sbjct: 39 GVKPEKVEVDESCEGVEGKEECLM-RRTLAAHLDYIYTQKHKP 80 >XP_002285430.1 PREDICTED: phytosulfokines 3 [Vitis vinifera] CBI19372.3 unnamed protein product, partial [Vitis vinifera] Length = 83 Score = 53.9 bits (128), Expect = 4e-06 Identities = 28/39 (71%), Positives = 29/39 (74%) Frame = +3 Query: 369 EVVGERRLCEGVVDDDECLMMRRTLVAHLDYIYTQKEKP 485 EVVG CEG D DECLM RRTL AH DYIYTQK+KP Sbjct: 48 EVVGGS--CEGAADKDECLM-RRTLAAHTDYIYTQKQKP 83