BLASTX nr result
ID: Lithospermum23_contig00008168
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00008168 (307 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007131463.1 hypothetical protein PHAVU_011G015600g [Phaseolus... 53 5e-06 >XP_007131463.1 hypothetical protein PHAVU_011G015600g [Phaseolus vulgaris] ESW03457.1 hypothetical protein PHAVU_011G015600g [Phaseolus vulgaris] Length = 240 Score = 52.8 bits (125), Expect = 5e-06 Identities = 24/32 (75%), Positives = 31/32 (96%), Gaps = 1/32 (3%) Frame = +3 Query: 213 EERNESKYVKLTKEQSP-QEITPGELNQPIEV 305 EERN+S+YVKLTK+Q+P ++ITPGELNQPI+V Sbjct: 2 EERNQSRYVKLTKDQTPTEDITPGELNQPIQV 33