BLASTX nr result
ID: Lithospermum23_contig00007598
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00007598 (336 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007142368.1 hypothetical protein PHAVU_008G274400g [Phaseolus... 62 5e-09 EPZ32561.1 RmlC-like jelly roll fold domain-containing protein [... 61 1e-08 GAU25097.1 hypothetical protein TSUD_257910, partial [Trifolium ... 60 1e-08 KYP59512.1 Pirin-like protein At1g50590 family [Cajanus cajan] 60 2e-08 KRH73851.1 hypothetical protein GLYMA_02G296500 [Glycine max] 60 2e-08 KHN43861.1 Pirin-like protein [Glycine soja] 60 2e-08 KHN23876.1 Pirin-like protein [Glycine soja] 60 2e-08 XP_003544719.1 PREDICTED: pirin-like protein [Glycine max] KRH14... 60 2e-08 ACU23860.1 unknown [Glycine max] 60 2e-08 NP_001242501.1 uncharacterized protein LOC100811930 [Glycine max... 60 2e-08 XP_010252672.1 PREDICTED: pirin-like protein isoform X2 [Nelumbo... 60 2e-08 XP_004491452.1 PREDICTED: pirin-like protein [Cicer arietinum] 60 2e-08 XP_010252671.1 PREDICTED: pirin-like protein isoform X1 [Nelumbo... 60 2e-08 XP_007146560.1 hypothetical protein PHAVU_006G050900g [Phaseolus... 60 3e-08 XP_016707264.1 PREDICTED: pirin-like protein [Gossypium hirsutum] 60 3e-08 XP_012461360.1 PREDICTED: pirin-like protein [Gossypium raimondi... 60 3e-08 KJB62878.1 hypothetical protein B456_009G445500 [Gossypium raimo... 59 4e-08 XP_016701815.1 PREDICTED: pirin-like protein [Gossypium hirsutum] 59 4e-08 XP_017640904.1 PREDICTED: pirin-like protein [Gossypium arboreum... 59 4e-08 XP_016684967.1 PREDICTED: pirin-like protein At1g50590 isoform X... 59 6e-08 >XP_007142368.1 hypothetical protein PHAVU_008G274400g [Phaseolus vulgaris] ESW14362.1 hypothetical protein PHAVU_008G274400g [Phaseolus vulgaris] Length = 301 Score = 62.0 bits (149), Expect = 5e-09 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -2 Query: 335 GPFVMNTEEEIEKTFSDYFSYTNGFEKARSWKSENA 228 GPFVMNT+EEI++T DY +YTNGFEKAR W+SE+A Sbjct: 261 GPFVMNTQEEIDQTIDDYENYTNGFEKARHWRSESA 296 >EPZ32561.1 RmlC-like jelly roll fold domain-containing protein [Rozella allomycis CSF55] Length = 299 Score = 60.8 bits (146), Expect = 1e-08 Identities = 24/37 (64%), Positives = 33/37 (89%) Frame = -2 Query: 335 GPFVMNTEEEIEKTFSDYFSYTNGFEKARSWKSENAR 225 GPFVMNT+EE++K F DYFS+ NGFEKA++W+S+ +R Sbjct: 260 GPFVMNTKEELQKAFEDYFSFKNGFEKAKNWESQISR 296 >GAU25097.1 hypothetical protein TSUD_257910, partial [Trifolium subterraneum] Length = 262 Score = 60.5 bits (145), Expect = 1e-08 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = -2 Query: 335 GPFVMNTEEEIEKTFSDYFSYTNGFEKARSWKSENARG 222 GPFVMNT+EEI++T D+ +YTNGFEKAR W+S++A G Sbjct: 222 GPFVMNTQEEIDQTIDDFENYTNGFEKARHWRSQSAIG 259 >KYP59512.1 Pirin-like protein At1g50590 family [Cajanus cajan] Length = 301 Score = 60.5 bits (145), Expect = 2e-08 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -2 Query: 335 GPFVMNTEEEIEKTFSDYFSYTNGFEKARSWKSENA 228 GPFVMNT+EEI++T D+ +YTNGFEKAR W+SE+A Sbjct: 261 GPFVMNTQEEIDQTIDDFENYTNGFEKARHWRSESA 296 >KRH73851.1 hypothetical protein GLYMA_02G296500 [Glycine max] Length = 301 Score = 60.5 bits (145), Expect = 2e-08 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -2 Query: 335 GPFVMNTEEEIEKTFSDYFSYTNGFEKARSWKSENA 228 GPFVMNT+EEI++T D+ +YTNGFEKAR W+SE+A Sbjct: 261 GPFVMNTQEEIDQTIDDFENYTNGFEKARHWRSESA 296 >KHN43861.1 Pirin-like protein [Glycine soja] Length = 301 Score = 60.5 bits (145), Expect = 2e-08 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -2 Query: 335 GPFVMNTEEEIEKTFSDYFSYTNGFEKARSWKSENA 228 GPFVMNT+EEI++T D+ +YTNGFEKAR W+SE+A Sbjct: 261 GPFVMNTQEEIDQTIDDFENYTNGFEKARHWRSESA 296 >KHN23876.1 Pirin-like protein [Glycine soja] Length = 301 Score = 60.5 bits (145), Expect = 2e-08 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -2 Query: 335 GPFVMNTEEEIEKTFSDYFSYTNGFEKARSWKSENA 228 GPFVMNT+EEI++T D+ +YTNGFEKAR W+SE+A Sbjct: 261 GPFVMNTQEEIDQTIDDFENYTNGFEKARHWRSESA 296 >XP_003544719.1 PREDICTED: pirin-like protein [Glycine max] KRH14295.1 hypothetical protein GLYMA_14G017000 [Glycine max] Length = 301 Score = 60.5 bits (145), Expect = 2e-08 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -2 Query: 335 GPFVMNTEEEIEKTFSDYFSYTNGFEKARSWKSENA 228 GPFVMNT+EEI++T D+ +YTNGFEKAR W+SE+A Sbjct: 261 GPFVMNTQEEIDQTIDDFENYTNGFEKARHWRSESA 296 >ACU23860.1 unknown [Glycine max] Length = 301 Score = 60.5 bits (145), Expect = 2e-08 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -2 Query: 335 GPFVMNTEEEIEKTFSDYFSYTNGFEKARSWKSENA 228 GPFVMNT+EEI++T D+ +YTNGFEKAR W+SE+A Sbjct: 261 GPFVMNTQEEIDQTIDDFENYTNGFEKARHWRSESA 296 >NP_001242501.1 uncharacterized protein LOC100811930 [Glycine max] ACU20099.1 unknown [Glycine max] Length = 301 Score = 60.5 bits (145), Expect = 2e-08 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -2 Query: 335 GPFVMNTEEEIEKTFSDYFSYTNGFEKARSWKSENA 228 GPFVMNT+EEI++T D+ +YTNGFEKAR W+SE+A Sbjct: 261 GPFVMNTQEEIDQTIDDFENYTNGFEKARHWRSESA 296 >XP_010252672.1 PREDICTED: pirin-like protein isoform X2 [Nelumbo nucifera] Length = 259 Score = 60.1 bits (144), Expect = 2e-08 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = -2 Query: 335 GPFVMNTEEEIEKTFSDYFSYTNGFEKARSWKSEN 231 GPFVMNT+EEI+KT DY YTNGFEKA++W+S++ Sbjct: 219 GPFVMNTQEEIDKTIDDYQQYTNGFEKAKNWRSQS 253 >XP_004491452.1 PREDICTED: pirin-like protein [Cicer arietinum] Length = 296 Score = 60.1 bits (144), Expect = 2e-08 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = -2 Query: 335 GPFVMNTEEEIEKTFSDYFSYTNGFEKARSWKSENARG 222 GPFVMNT+EEI++T D+ +YTNGFEKAR WKS++ G Sbjct: 256 GPFVMNTQEEIDQTIDDFENYTNGFEKARHWKSDSVVG 293 >XP_010252671.1 PREDICTED: pirin-like protein isoform X1 [Nelumbo nucifera] Length = 301 Score = 60.1 bits (144), Expect = 2e-08 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = -2 Query: 335 GPFVMNTEEEIEKTFSDYFSYTNGFEKARSWKSEN 231 GPFVMNT+EEI+KT DY YTNGFEKA++W+S++ Sbjct: 261 GPFVMNTQEEIDKTIDDYQQYTNGFEKAKNWRSQS 295 >XP_007146560.1 hypothetical protein PHAVU_006G050900g [Phaseolus vulgaris] ESW18554.1 hypothetical protein PHAVU_006G050900g [Phaseolus vulgaris] Length = 299 Score = 59.7 bits (143), Expect = 3e-08 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = -2 Query: 335 GPFVMNTEEEIEKTFSDYFSYTNGFEKARSWKSEN 231 GPFVMNT+EEI++T D+ ++TNGFEKAR W+SEN Sbjct: 262 GPFVMNTQEEIDQTIDDFENFTNGFEKARDWRSEN 296 >XP_016707264.1 PREDICTED: pirin-like protein [Gossypium hirsutum] Length = 302 Score = 59.7 bits (143), Expect = 3e-08 Identities = 24/35 (68%), Positives = 32/35 (91%) Frame = -2 Query: 335 GPFVMNTEEEIEKTFSDYFSYTNGFEKARSWKSEN 231 GPFVMNT+EEI++T +D+ +YTNGFEKAR W+SE+ Sbjct: 262 GPFVMNTQEEIDRTINDFENYTNGFEKARHWRSES 296 >XP_012461360.1 PREDICTED: pirin-like protein [Gossypium raimondii] KJB13803.1 hypothetical protein B456_002G095100 [Gossypium raimondii] Length = 302 Score = 59.7 bits (143), Expect = 3e-08 Identities = 24/35 (68%), Positives = 32/35 (91%) Frame = -2 Query: 335 GPFVMNTEEEIEKTFSDYFSYTNGFEKARSWKSEN 231 GPFVMNT+EEI++T +D+ +YTNGFEKAR W+SE+ Sbjct: 262 GPFVMNTQEEIDRTINDFENYTNGFEKARHWRSES 296 >KJB62878.1 hypothetical protein B456_009G445500 [Gossypium raimondii] Length = 225 Score = 58.9 bits (141), Expect = 4e-08 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = -2 Query: 335 GPFVMNTEEEIEKTFSDYFSYTNGFEKARSWKSEN 231 GPFVMNT+EEI++T D+ +YTNGFEKAR W+SE+ Sbjct: 185 GPFVMNTQEEIDQTIEDFENYTNGFEKARHWRSES 219 >XP_016701815.1 PREDICTED: pirin-like protein [Gossypium hirsutum] Length = 302 Score = 59.3 bits (142), Expect = 4e-08 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = -2 Query: 335 GPFVMNTEEEIEKTFSDYFSYTNGFEKARSWKSEN 231 GPFVMNT+EEI++T D+ +YTNGFEKAR W+SE+ Sbjct: 262 GPFVMNTQEEIDRTIDDFENYTNGFEKARHWRSES 296 >XP_017640904.1 PREDICTED: pirin-like protein [Gossypium arboreum] KHF98593.1 hypothetical protein F383_12320 [Gossypium arboreum] Length = 302 Score = 59.3 bits (142), Expect = 4e-08 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = -2 Query: 335 GPFVMNTEEEIEKTFSDYFSYTNGFEKARSWKSEN 231 GPFVMNT+EEI++T D+ +YTNGFEKAR W+SE+ Sbjct: 262 GPFVMNTQEEIDRTIDDFENYTNGFEKARHWRSES 296 >XP_016684967.1 PREDICTED: pirin-like protein At1g50590 isoform X2 [Gossypium hirsutum] Length = 288 Score = 58.9 bits (141), Expect = 6e-08 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = -2 Query: 335 GPFVMNTEEEIEKTFSDYFSYTNGFEKARSWKSEN 231 GPFVMNT+EEI++T D+ +YTNGFEKAR W+SE+ Sbjct: 248 GPFVMNTQEEIDQTIEDFENYTNGFEKARHWRSES 282