BLASTX nr result
ID: Lithospermum23_contig00007548
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00007548 (1260 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003596701.1 cystatin domain protein [Medicago truncatula] AES... 60 1e-06 >XP_003596701.1 cystatin domain protein [Medicago truncatula] AES66952.1 cystatin domain protein [Medicago truncatula] Length = 231 Score = 60.1 bits (144), Expect = 1e-06 Identities = 41/111 (36%), Positives = 56/111 (50%), Gaps = 2/111 (1%) Frame = +1 Query: 622 PRTFAKLKNPKEKLFKYEMLQLCARLATREYNNLENTDYQFVDIEKVAYKVVGGILYYII 801 P F +K+P +K + + CA LA R+YN+ DYQ V ++ + V G LY I Sbjct: 73 PSDFNDIKDPTKK----DRITKCATLAIRDYNSQTQNDYQLVVVDTFTSQFVNGFLYCIT 128 Query: 802 FQAKAEQSE--TFETIVFRERNGIENGSTNHVQRVRINRPGSIWHDGTLKE 948 FQA E TFE IVF G V R+RI + S W++GTL + Sbjct: 129 FQASNADKEYATFEAIVF--GYGKREFDLRKVIRIRI-KGTSTWYNGTLMQ 176