BLASTX nr result
ID: Lithospermum23_contig00007161
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00007161 (429 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016546402.1 PREDICTED: glutathione S-transferase U17-like [Ca... 55 6e-07 OMO51655.1 hypothetical protein CCACVL1_29671 [Corchorus capsula... 52 5e-06 >XP_016546402.1 PREDICTED: glutathione S-transferase U17-like [Capsicum annuum] Length = 131 Score = 55.1 bits (131), Expect = 6e-07 Identities = 22/39 (56%), Positives = 30/39 (76%) Frame = -2 Query: 428 TPCLFKWTKDICEDPATKDAIPETEKMLEYAKMIVAWMR 312 TPCL+KW +D C D A KD +PET+K+ + AK+I+A MR Sbjct: 84 TPCLYKWAEDFCADSAVKDVMPETDKLADAAKVIMAKMR 122 >OMO51655.1 hypothetical protein CCACVL1_29671 [Corchorus capsularis] Length = 119 Score = 52.4 bits (124), Expect = 5e-06 Identities = 22/39 (56%), Positives = 27/39 (69%) Frame = -2 Query: 428 TPCLFKWTKDICEDPATKDAIPETEKMLEYAKMIVAWMR 312 TP L KW + C D A KD +PETEK+LE+ K+I A MR Sbjct: 72 TPALLKWADNFCSDAAVKDVMPETEKLLEFGKIITAKMR 110