BLASTX nr result
ID: Lithospermum23_contig00006959
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00006959 (716 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015080898.1 PREDICTED: mitochondrial import receptor subunit ... 100 8e-24 XP_016459629.1 PREDICTED: mitochondrial import receptor subunit ... 99 2e-23 XP_009768665.1 PREDICTED: mitochondrial import receptor subunit ... 99 2e-23 XP_012850170.1 PREDICTED: mitochondrial import receptor subunit ... 99 3e-23 O82067.3 RecName: Full=Mitochondrial import receptor subunit TOM... 98 4e-23 XP_009628067.1 PREDICTED: mitochondrial import receptor subunit ... 98 4e-23 XP_004242882.1 PREDICTED: mitochondrial import receptor subunit ... 98 4e-23 KZV34331.1 hypothetical protein F511_37581 [Dorcoceras hygrometr... 97 9e-23 XP_011077684.1 PREDICTED: mitochondrial import receptor subunit ... 96 3e-22 XP_016580238.1 PREDICTED: mitochondrial import receptor subunit ... 95 7e-22 XP_011077105.1 PREDICTED: mitochondrial import receptor subunit ... 94 1e-21 XP_004240126.1 PREDICTED: mitochondrial import receptor subunit ... 93 4e-21 XP_006360661.1 PREDICTED: mitochondrial import receptor subunit ... 92 1e-20 EPS63209.1 hypothetical protein M569_11578 [Genlisea aurea] 91 2e-20 XP_008391413.1 PREDICTED: mitochondrial import receptor subunit ... 91 3e-20 XP_004299770.1 PREDICTED: mitochondrial import receptor subunit ... 91 3e-20 XP_010106954.1 Mitochondrial import receptor subunit TOM7-1 [Mor... 89 1e-19 KVI01446.1 Mitochondrial import receptor subunit TOM7 [Cynara ca... 89 1e-19 KVH88464.1 Mitochondrial import receptor subunit TOM7 [Cynara ca... 89 1e-19 XP_015627058.1 PREDICTED: mitochondrial import receptor subunit ... 89 2e-19 >XP_015080898.1 PREDICTED: mitochondrial import receptor subunit TOM7-1 [Solanum pennellii] XP_015080901.1 PREDICTED: mitochondrial import receptor subunit TOM7-1 [Solanum pennellii] Length = 77 Score = 100 bits (248), Expect = 8e-24 Identities = 47/57 (82%), Positives = 49/57 (85%) Frame = +2 Query: 161 DGDDSITAAAAKFVKEWTNWTAKKAKVVTHYGFIPLIIIIGMNSDPKPSLSQLLSPV 331 D DD AA KFVKEW WTAKKAKVVTHYGFIPL+IIIGMNS+PKPSLSQLLSPV Sbjct: 21 DEDDGAVAAVGKFVKEWGTWTAKKAKVVTHYGFIPLVIIIGMNSEPKPSLSQLLSPV 77 >XP_016459629.1 PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Nicotiana tabacum] Length = 77 Score = 99.4 bits (246), Expect = 2e-23 Identities = 45/57 (78%), Positives = 50/57 (87%) Frame = +2 Query: 161 DGDDSITAAAAKFVKEWTNWTAKKAKVVTHYGFIPLIIIIGMNSDPKPSLSQLLSPV 331 D DD AA +KFVKEW WTAKKAKV+THYGFIPL+II+GMNS+PKPSLSQLLSPV Sbjct: 21 DEDDGAVAAVSKFVKEWGTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLLSPV 77 >XP_009768665.1 PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Nicotiana sylvestris] XP_016491518.1 PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Nicotiana tabacum] Length = 77 Score = 99.0 bits (245), Expect = 2e-23 Identities = 45/57 (78%), Positives = 50/57 (87%) Frame = +2 Query: 161 DGDDSITAAAAKFVKEWTNWTAKKAKVVTHYGFIPLIIIIGMNSDPKPSLSQLLSPV 331 D DD AA +KFVKEW WTAKKAKV+THYGFIPL+II+GMNS+PKPSLSQLLSPV Sbjct: 21 DEDDGAVAALSKFVKEWGTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLLSPV 77 >XP_012850170.1 PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Erythranthe guttata] EYU26552.1 hypothetical protein MIMGU_mgv1a017391mg [Erythranthe guttata] Length = 78 Score = 98.6 bits (244), Expect = 3e-23 Identities = 45/55 (81%), Positives = 49/55 (89%) Frame = +2 Query: 167 DDSITAAAAKFVKEWTNWTAKKAKVVTHYGFIPLIIIIGMNSDPKPSLSQLLSPV 331 D+ A AAKFVKEW+ WT KKAKV+THYGFIPL+IIIGMNSDPKPSLSQLLSPV Sbjct: 24 DEGSVAVAAKFVKEWSTWTMKKAKVITHYGFIPLVIIIGMNSDPKPSLSQLLSPV 78 >O82067.3 RecName: Full=Mitochondrial import receptor subunit TOM7-1; AltName: Full=Translocase of outer membrane 7 kDa subunit 1 CAA76125.1 TOM7 protein [Solanum tuberosum] Length = 72 Score = 98.2 bits (243), Expect = 4e-23 Identities = 45/57 (78%), Positives = 48/57 (84%) Frame = +2 Query: 161 DGDDSITAAAAKFVKEWTNWTAKKAKVVTHYGFIPLIIIIGMNSDPKPSLSQLLSPV 331 D DD A KFVKEW WTAKKAKV+THYGFIPL+IIIGMNS+PKPSLSQLLSPV Sbjct: 16 DEDDGAVAVVGKFVKEWGTWTAKKAKVITHYGFIPLVIIIGMNSEPKPSLSQLLSPV 72 >XP_009628067.1 PREDICTED: mitochondrial import receptor subunit TOM7-1 [Nicotiana tomentosiformis] XP_009798962.1 PREDICTED: mitochondrial import receptor subunit TOM7-1 [Nicotiana sylvestris] XP_016473319.1 PREDICTED: mitochondrial import receptor subunit TOM7-1 [Nicotiana tabacum] XP_019261090.1 PREDICTED: mitochondrial import receptor subunit TOM7-1 [Nicotiana attenuata] Length = 77 Score = 98.2 bits (243), Expect = 4e-23 Identities = 45/57 (78%), Positives = 48/57 (84%) Frame = +2 Query: 161 DGDDSITAAAAKFVKEWTNWTAKKAKVVTHYGFIPLIIIIGMNSDPKPSLSQLLSPV 331 D DD A KFVKEW WTAKKAKV+THYGFIPL+IIIGMNS+PKPSLSQLLSPV Sbjct: 21 DEDDGAVAVVGKFVKEWGTWTAKKAKVITHYGFIPLVIIIGMNSEPKPSLSQLLSPV 77 >XP_004242882.1 PREDICTED: mitochondrial import receptor subunit TOM7-1 [Solanum lycopersicum] Length = 77 Score = 98.2 bits (243), Expect = 4e-23 Identities = 45/57 (78%), Positives = 49/57 (85%) Frame = +2 Query: 161 DGDDSITAAAAKFVKEWTNWTAKKAKVVTHYGFIPLIIIIGMNSDPKPSLSQLLSPV 331 D DD AA KFVKEW W+AKKAKV+THYGFIPL+IIIGMNS+PKPSLSQLLSPV Sbjct: 21 DEDDGAVAAVGKFVKEWGTWSAKKAKVITHYGFIPLVIIIGMNSEPKPSLSQLLSPV 77 >KZV34331.1 hypothetical protein F511_37581 [Dorcoceras hygrometricum] Length = 78 Score = 97.4 bits (241), Expect = 9e-23 Identities = 44/57 (77%), Positives = 50/57 (87%) Frame = +2 Query: 161 DGDDSITAAAAKFVKEWTNWTAKKAKVVTHYGFIPLIIIIGMNSDPKPSLSQLLSPV 331 D D S A AA+FVKEW+ WT KKAKV+THYGFIPL+I+IGMNS+PKPSLSQLLSPV Sbjct: 22 DEDGSTVAVAARFVKEWSTWTMKKAKVITHYGFIPLVILIGMNSEPKPSLSQLLSPV 78 >XP_011077684.1 PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Sesamum indicum] Length = 78 Score = 95.9 bits (237), Expect = 3e-22 Identities = 43/57 (75%), Positives = 50/57 (87%) Frame = +2 Query: 161 DGDDSITAAAAKFVKEWTNWTAKKAKVVTHYGFIPLIIIIGMNSDPKPSLSQLLSPV 331 D ++ A AAKFVKEW+ WT KKAKV+THYGFIP++IIIGMNS+PKPSLSQLLSPV Sbjct: 22 DEEEGSMAVAAKFVKEWSTWTMKKAKVITHYGFIPMVIIIGMNSEPKPSLSQLLSPV 78 >XP_016580238.1 PREDICTED: mitochondrial import receptor subunit TOM7-1 [Capsicum annuum] Length = 77 Score = 95.1 bits (235), Expect = 7e-22 Identities = 43/57 (75%), Positives = 47/57 (82%) Frame = +2 Query: 161 DGDDSITAAAAKFVKEWTNWTAKKAKVVTHYGFIPLIIIIGMNSDPKPSLSQLLSPV 331 D +D KFVKEW WTAKKAKV+THYGFIPL+IIIGMNS+PKPSLSQLLSPV Sbjct: 21 DEEDGAVVVVGKFVKEWGTWTAKKAKVITHYGFIPLVIIIGMNSEPKPSLSQLLSPV 77 >XP_011077105.1 PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Sesamum indicum] Length = 78 Score = 94.4 bits (233), Expect = 1e-21 Identities = 42/57 (73%), Positives = 49/57 (85%) Frame = +2 Query: 161 DGDDSITAAAAKFVKEWTNWTAKKAKVVTHYGFIPLIIIIGMNSDPKPSLSQLLSPV 331 D ++ AAKFVKEW+ WT KKAKV+THYGFIP++IIIGMNS+PKPSLSQLLSPV Sbjct: 22 DEEEGSMVVAAKFVKEWSTWTMKKAKVITHYGFIPMVIIIGMNSEPKPSLSQLLSPV 78 >XP_004240126.1 PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Solanum lycopersicum] XP_015074921.1 PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Solanum pennellii] Length = 78 Score = 93.2 bits (230), Expect = 4e-21 Identities = 42/57 (73%), Positives = 47/57 (82%) Frame = +2 Query: 161 DGDDSITAAAAKFVKEWTNWTAKKAKVVTHYGFIPLIIIIGMNSDPKPSLSQLLSPV 331 D D A FVK+WT WTAKKAKV+THYGFIPL+II+GMNS+PKPSLSQLLSPV Sbjct: 22 DEDGGAVTAVYTFVKDWTTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLLSPV 78 >XP_006360661.1 PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Solanum tuberosum] Length = 78 Score = 91.7 bits (226), Expect = 1e-20 Identities = 41/57 (71%), Positives = 47/57 (82%) Frame = +2 Query: 161 DGDDSITAAAAKFVKEWTNWTAKKAKVVTHYGFIPLIIIIGMNSDPKPSLSQLLSPV 331 D D A FVK+W+ WTAKKAKV+THYGFIPL+II+GMNS+PKPSLSQLLSPV Sbjct: 22 DEDGGAVTAVYTFVKDWSTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLLSPV 78 >EPS63209.1 hypothetical protein M569_11578 [Genlisea aurea] Length = 81 Score = 91.3 bits (225), Expect = 2e-20 Identities = 41/55 (74%), Positives = 48/55 (87%) Frame = +2 Query: 167 DDSITAAAAKFVKEWTNWTAKKAKVVTHYGFIPLIIIIGMNSDPKPSLSQLLSPV 331 ++ AAA K VK+W+NW KKAKV+THYGFIPLIIIIGMNS+PKPS+SQLLSPV Sbjct: 27 EEGSAAAATKLVKQWSNWGLKKAKVITHYGFIPLIIIIGMNSEPKPSISQLLSPV 81 >XP_008391413.1 PREDICTED: mitochondrial import receptor subunit TOM7-1 [Malus domestica] Length = 73 Score = 90.9 bits (224), Expect = 3e-20 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = +2 Query: 185 AAAKFVKEWTNWTAKKAKVVTHYGFIPLIIIIGMNSDPKPSLSQLLSPV 331 + A+FVKEW+ WT KKAKVVTHYGFIPL+IIIGMNSDPKP LSQLLSPV Sbjct: 25 SVAQFVKEWSTWTMKKAKVVTHYGFIPLVIIIGMNSDPKPQLSQLLSPV 73 >XP_004299770.1 PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Fragaria vesca subsp. vesca] Length = 73 Score = 90.9 bits (224), Expect = 3e-20 Identities = 46/53 (86%), Positives = 46/53 (86%) Frame = +2 Query: 173 SITAAAAKFVKEWTNWTAKKAKVVTHYGFIPLIIIIGMNSDPKPSLSQLLSPV 331 SIT A VKEWTNWT KKAKVVTHYGFIPLIIIIGMNSDPKP LSQLLSPV Sbjct: 25 SITQA----VKEWTNWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQLSQLLSPV 73 >XP_010106954.1 Mitochondrial import receptor subunit TOM7-1 [Morus notabilis] EXC12836.1 Mitochondrial import receptor subunit TOM7-1 [Morus notabilis] Length = 71 Score = 89.4 bits (220), Expect = 1e-19 Identities = 40/49 (81%), Positives = 44/49 (89%) Frame = +2 Query: 185 AAAKFVKEWTNWTAKKAKVVTHYGFIPLIIIIGMNSDPKPSLSQLLSPV 331 + A+ VKEWT W AKKAKV+THYGFIPL+IIIGMNSDPKP LSQLLSPV Sbjct: 23 STAQLVKEWTTWAAKKAKVITHYGFIPLVIIIGMNSDPKPHLSQLLSPV 71 >KVI01446.1 Mitochondrial import receptor subunit TOM7 [Cynara cardunculus var. scolymus] Length = 72 Score = 89.0 bits (219), Expect = 1e-19 Identities = 42/55 (76%), Positives = 48/55 (87%) Frame = +2 Query: 167 DDSITAAAAKFVKEWTNWTAKKAKVVTHYGFIPLIIIIGMNSDPKPSLSQLLSPV 331 DD+ T+ K +KEW+ WT KKAKV+THYGFIPLIIIIGMNSDPKPS+SQLLSPV Sbjct: 21 DDNSTS---KLLKEWSTWTIKKAKVITHYGFIPLIIIIGMNSDPKPSISQLLSPV 72 >KVH88464.1 Mitochondrial import receptor subunit TOM7 [Cynara cardunculus var. scolymus] Length = 72 Score = 89.0 bits (219), Expect = 1e-19 Identities = 39/53 (73%), Positives = 46/53 (86%) Frame = +2 Query: 173 SITAAAAKFVKEWTNWTAKKAKVVTHYGFIPLIIIIGMNSDPKPSLSQLLSPV 331 S+ + +K KEW+ WT KKAKV+THYGFIPLII+IGMNSDPKPS+SQLLSPV Sbjct: 20 SVDNSTSKLFKEWSTWTIKKAKVITHYGFIPLIIVIGMNSDPKPSISQLLSPV 72 >XP_015627058.1 PREDICTED: mitochondrial import receptor subunit TOM7-1 [Oryza sativa Japonica Group] BAB19073.1 TOM7-like protein [Oryza sativa Japonica Group] BAD61183.1 TOM7-like protein [Oryza sativa Japonica Group] BAF05541.1 Os01g0626300 [Oryza sativa Japonica Group] EAY75031.1 hypothetical protein OsI_02929 [Oryza sativa Indica Group] EAZ12755.1 hypothetical protein OsJ_02673 [Oryza sativa Japonica Group] BAS73254.1 Os01g0626300 [Oryza sativa Japonica Group] Length = 80 Score = 89.0 bits (219), Expect = 2e-19 Identities = 39/57 (68%), Positives = 46/57 (80%) Frame = +2 Query: 161 DGDDSITAAAAKFVKEWTNWTAKKAKVVTHYGFIPLIIIIGMNSDPKPSLSQLLSPV 331 D + S AAA +FVKEWT WT KK KV HYGFIPLII++GM S+P+PSL+QLLSPV Sbjct: 24 DEEQSTAAAAVRFVKEWTTWTMKKTKVAAHYGFIPLIIVVGMRSEPRPSLAQLLSPV 80