BLASTX nr result
ID: Lithospermum23_contig00006683
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00006683 (392 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT43050.1 Proteasome subunit alpha type-2-A [Anthurium amnicola] 84 9e-19 XP_017249330.1 PREDICTED: proteasome subunit alpha type-2-A [Dau... 87 1e-18 XP_017247948.1 PREDICTED: proteasome subunit alpha type-2-A [Dau... 87 1e-18 XP_006377038.1 hypothetical protein POPTR_0012s12320g [Populus t... 84 2e-18 XP_009361834.1 PREDICTED: proteasome subunit alpha type-2-A [Pyr... 87 3e-18 XP_008383098.1 PREDICTED: proteasome subunit alpha type-2-A-like... 87 3e-18 XP_008372018.1 PREDICTED: proteasome subunit alpha type-2-A-like... 87 3e-18 GAV91636.1 Proteasome domain-containing protein [Cephalotus foll... 85 3e-18 XP_011001365.1 PREDICTED: proteasome subunit alpha type-2-A-like... 84 6e-18 OAY30181.1 hypothetical protein MANES_14G010700 [Manihot esculenta] 86 7e-18 KHN47441.1 Proteasome subunit alpha type-2-A [Glycine soja] 86 7e-18 XP_012087375.1 PREDICTED: proteasome subunit alpha type-2-A [Jat... 86 7e-18 XP_002513374.1 PREDICTED: proteasome subunit alpha type-2-A [Ric... 86 7e-18 XP_007149306.1 hypothetical protein PHAVU_005G059300g [Phaseolus... 86 7e-18 NP_001240931.1 uncharacterized protein LOC100799108 [Glycine max... 86 7e-18 XP_019443721.1 PREDICTED: proteasome subunit alpha type-2-A [Lup... 85 1e-17 XP_019192862.1 PREDICTED: proteasome subunit alpha type-2-A [Ipo... 85 1e-17 XP_008371891.1 PREDICTED: proteasome subunit alpha type-2-B [Mal... 85 1e-17 XP_008226117.1 PREDICTED: proteasome subunit alpha type-2-B [Pru... 85 1e-17 XP_004509539.1 PREDICTED: proteasome subunit alpha type-2-A [Cic... 85 1e-17 >JAT43050.1 Proteasome subunit alpha type-2-A [Anthurium amnicola] Length = 100 Score = 84.3 bits (207), Expect = 9e-19 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = -3 Query: 390 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPSEIEDYLQEVE 256 AILTLKEGFEGQISGKNIEIGIIGAD+KFRVLTP+EI+DYL EVE Sbjct: 56 AILTLKEGFEGQISGKNIEIGIIGADRKFRVLTPAEIDDYLAEVE 100 >XP_017249330.1 PREDICTED: proteasome subunit alpha type-2-A [Daucus carota subsp. sativus] XP_017249331.1 PREDICTED: proteasome subunit alpha type-2-A [Daucus carota subsp. sativus] XP_017249332.1 PREDICTED: proteasome subunit alpha type-2-A [Daucus carota subsp. sativus] XP_017249333.1 PREDICTED: proteasome subunit alpha type-2-A [Daucus carota subsp. sativus] Length = 235 Score = 87.4 bits (215), Expect = 1e-18 Identities = 43/45 (95%), Positives = 45/45 (100%) Frame = -3 Query: 390 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPSEIEDYLQEVE 256 AILTLKEGFEGQISGKNIEIGIIGADK+FRVLTP+EIEDYLQEVE Sbjct: 191 AILTLKEGFEGQISGKNIEIGIIGADKQFRVLTPAEIEDYLQEVE 235 >XP_017247948.1 PREDICTED: proteasome subunit alpha type-2-A [Daucus carota subsp. sativus] Length = 235 Score = 87.4 bits (215), Expect = 1e-18 Identities = 43/45 (95%), Positives = 45/45 (100%) Frame = -3 Query: 390 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPSEIEDYLQEVE 256 AILTLKEGFEGQISGKNIEIGIIGADK+FRVLTP+EIEDYLQEVE Sbjct: 191 AILTLKEGFEGQISGKNIEIGIIGADKQFRVLTPAEIEDYLQEVE 235 >XP_006377038.1 hypothetical protein POPTR_0012s12320g [Populus trichocarpa] ERP54835.1 hypothetical protein POPTR_0012s12320g [Populus trichocarpa] Length = 118 Score = 84.0 bits (206), Expect = 2e-18 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = -3 Query: 390 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPSEIEDYLQEVE 256 AILTLKEGFEGQISGKNIEIGIIGADK+FRVLTP+EI+DYL EVE Sbjct: 74 AILTLKEGFEGQISGKNIEIGIIGADKQFRVLTPAEIDDYLAEVE 118 >XP_009361834.1 PREDICTED: proteasome subunit alpha type-2-A [Pyrus x bretschneideri] XP_009361836.1 PREDICTED: proteasome subunit alpha type-2-A [Pyrus x bretschneideri] XP_009361837.1 PREDICTED: proteasome subunit alpha type-2-A [Pyrus x bretschneideri] Length = 235 Score = 86.7 bits (213), Expect = 3e-18 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -3 Query: 390 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPSEIEDYLQEVE 256 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTP+EIEDYL EVE Sbjct: 191 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPAEIEDYLAEVE 235 >XP_008383098.1 PREDICTED: proteasome subunit alpha type-2-A-like [Malus domestica] XP_009341710.1 PREDICTED: proteasome subunit alpha type-2-A-like [Pyrus x bretschneideri] Length = 235 Score = 86.7 bits (213), Expect = 3e-18 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -3 Query: 390 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPSEIEDYLQEVE 256 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTP+EIEDYL EVE Sbjct: 191 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPAEIEDYLAEVE 235 >XP_008372018.1 PREDICTED: proteasome subunit alpha type-2-A-like [Malus domestica] Length = 235 Score = 86.7 bits (213), Expect = 3e-18 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -3 Query: 390 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPSEIEDYLQEVE 256 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTP+EIEDYL EVE Sbjct: 191 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPAEIEDYLAEVE 235 >GAV91636.1 Proteasome domain-containing protein [Cephalotus follicularis] Length = 157 Score = 84.7 bits (208), Expect = 3e-18 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = -3 Query: 390 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPSEIEDYLQEVE 256 AILTLKEGFEGQISGKNIEIGIIG+DKKFRVLTP EI+DYL+EVE Sbjct: 113 AILTLKEGFEGQISGKNIEIGIIGSDKKFRVLTPEEIDDYLREVE 157 >XP_011001365.1 PREDICTED: proteasome subunit alpha type-2-A-like isoform X2 [Populus euphratica] XP_011001366.1 PREDICTED: proteasome subunit alpha type-2-A-like isoform X2 [Populus euphratica] Length = 162 Score = 84.0 bits (206), Expect = 6e-18 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = -3 Query: 390 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPSEIEDYLQEVE 256 AILTLKEGFEGQISGKNIEIGIIGADK+FRVLTP+EI+DYL EVE Sbjct: 118 AILTLKEGFEGQISGKNIEIGIIGADKQFRVLTPAEIDDYLAEVE 162 >OAY30181.1 hypothetical protein MANES_14G010700 [Manihot esculenta] Length = 235 Score = 85.5 bits (210), Expect = 7e-18 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -3 Query: 390 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPSEIEDYLQEVE 256 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTP+EI+DYL EVE Sbjct: 191 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPAEIDDYLAEVE 235 >KHN47441.1 Proteasome subunit alpha type-2-A [Glycine soja] Length = 235 Score = 85.5 bits (210), Expect = 7e-18 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -3 Query: 390 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPSEIEDYLQEVE 256 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTP+EI+DYL EVE Sbjct: 191 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPAEIDDYLAEVE 235 >XP_012087375.1 PREDICTED: proteasome subunit alpha type-2-A [Jatropha curcas] KDP25084.1 hypothetical protein JCGZ_22619 [Jatropha curcas] Length = 235 Score = 85.5 bits (210), Expect = 7e-18 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -3 Query: 390 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPSEIEDYLQEVE 256 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTP+EI+DYL EVE Sbjct: 191 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPAEIDDYLAEVE 235 >XP_002513374.1 PREDICTED: proteasome subunit alpha type-2-A [Ricinus communis] EEF48777.1 proteasome subunit alpha type, putative [Ricinus communis] Length = 235 Score = 85.5 bits (210), Expect = 7e-18 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -3 Query: 390 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPSEIEDYLQEVE 256 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTP+EI+DYL EVE Sbjct: 191 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPAEIDDYLAEVE 235 >XP_007149306.1 hypothetical protein PHAVU_005G059300g [Phaseolus vulgaris] ESW21300.1 hypothetical protein PHAVU_005G059300g [Phaseolus vulgaris] Length = 235 Score = 85.5 bits (210), Expect = 7e-18 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -3 Query: 390 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPSEIEDYLQEVE 256 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTP+EI+DYL EVE Sbjct: 191 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPAEIDDYLAEVE 235 >NP_001240931.1 uncharacterized protein LOC100799108 [Glycine max] XP_014493071.1 PREDICTED: proteasome subunit alpha type-2-A [Vigna radiata var. radiata] XP_006584581.2 PREDICTED: uncharacterized protein LOC100799108 isoform X1 [Glycine max] XP_017418992.1 PREDICTED: proteasome subunit alpha type-2-A [Vigna angularis] XP_017418993.1 PREDICTED: proteasome subunit alpha type-2-A [Vigna angularis] ACU21161.1 unknown [Glycine max] KHN26862.1 Proteasome subunit alpha type-2-A [Glycine soja] KOM38162.1 hypothetical protein LR48_Vigan03g154400 [Vigna angularis] KRH43726.1 hypothetical protein GLYMA_08G167600 [Glycine max] KRH43727.1 hypothetical protein GLYMA_08G167600 [Glycine max] KRH43728.1 hypothetical protein GLYMA_08G167600 [Glycine max] Length = 235 Score = 85.5 bits (210), Expect = 7e-18 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -3 Query: 390 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPSEIEDYLQEVE 256 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTP+EI+DYL EVE Sbjct: 191 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPAEIDDYLAEVE 235 >XP_019443721.1 PREDICTED: proteasome subunit alpha type-2-A [Lupinus angustifolius] XP_019443722.1 PREDICTED: proteasome subunit alpha type-2-A [Lupinus angustifolius] XP_019455762.1 PREDICTED: proteasome subunit alpha type-2-A [Lupinus angustifolius] XP_019455763.1 PREDICTED: proteasome subunit alpha type-2-A [Lupinus angustifolius] Length = 235 Score = 85.1 bits (209), Expect = 1e-17 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -3 Query: 390 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPSEIEDYLQEVE 256 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTP+EI+DYL EVE Sbjct: 191 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPAEIDDYLGEVE 235 >XP_019192862.1 PREDICTED: proteasome subunit alpha type-2-A [Ipomoea nil] Length = 235 Score = 85.1 bits (209), Expect = 1e-17 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -3 Query: 390 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPSEIEDYLQEVE 256 AILTLKEGFEGQISGKNIEIGIIGADK FRVLTP+EI+DYLQEVE Sbjct: 191 AILTLKEGFEGQISGKNIEIGIIGADKVFRVLTPAEIDDYLQEVE 235 >XP_008371891.1 PREDICTED: proteasome subunit alpha type-2-B [Malus domestica] XP_009353968.1 PREDICTED: proteasome subunit alpha type-2-B [Pyrus x bretschneideri] Length = 235 Score = 85.1 bits (209), Expect = 1e-17 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = -3 Query: 390 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPSEIEDYLQEVE 256 AILTLKEGFEGQISGKNIEIGIIG DKKFRVLTP+EIEDYL EVE Sbjct: 191 AILTLKEGFEGQISGKNIEIGIIGTDKKFRVLTPAEIEDYLAEVE 235 >XP_008226117.1 PREDICTED: proteasome subunit alpha type-2-B [Prunus mume] XP_008226119.1 PREDICTED: proteasome subunit alpha type-2-B [Prunus mume] ONI11938.1 hypothetical protein PRUPE_4G136000 [Prunus persica] ONI11939.1 hypothetical protein PRUPE_4G136000 [Prunus persica] ONI11940.1 hypothetical protein PRUPE_4G136000 [Prunus persica] Length = 235 Score = 85.1 bits (209), Expect = 1e-17 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = -3 Query: 390 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPSEIEDYLQEVE 256 AILTLKEGFEGQISGKNIEIGIIG DKKFRVLTP+EIEDYL EVE Sbjct: 191 AILTLKEGFEGQISGKNIEIGIIGTDKKFRVLTPAEIEDYLAEVE 235 >XP_004509539.1 PREDICTED: proteasome subunit alpha type-2-A [Cicer arietinum] Length = 235 Score = 85.1 bits (209), Expect = 1e-17 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -3 Query: 390 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPSEIEDYLQEVE 256 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTP+EI+DYL EVE Sbjct: 191 AILTLKEGFEGQISGKNIEIGIIGADKKFRVLTPAEIDDYLGEVE 235