BLASTX nr result
ID: Lithospermum23_contig00006255
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00006255 (582 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011100389.1 PREDICTED: cysteine-rich and transmembrane domain... 61 3e-09 XP_019193696.1 PREDICTED: cysteine-rich and transmembrane domain... 58 6e-08 KZV31369.1 hypothetical protein F511_05473 [Dorcoceras hygrometr... 57 1e-07 XP_019193697.1 PREDICTED: cysteine-rich and transmembrane domain... 57 2e-07 XP_015074979.1 PREDICTED: cysteine-rich and transmembrane domain... 55 3e-07 XP_004239248.1 PREDICTED: cysteine-rich and transmembrane domain... 55 3e-07 XP_009785011.1 PREDICTED: cysteine-rich and transmembrane domain... 55 5e-07 XP_016559282.1 PREDICTED: cysteine-rich and transmembrane domain... 54 1e-06 XP_019241385.1 PREDICTED: cysteine-rich and transmembrane domain... 54 1e-06 XP_009627959.1 PREDICTED: cysteine-rich and transmembrane domain... 54 2e-06 XP_006358049.1 PREDICTED: cysteine-rich and transmembrane domain... 53 4e-06 KCW88515.1 hypothetical protein EUGRSUZ_A00899 [Eucalyptus grandis] 52 5e-06 XP_010044693.1 PREDICTED: cysteine-rich and transmembrane domain... 52 8e-06 KHN26827.1 hypothetical protein glysoja_011419 [Glycine soja] 52 9e-06 >XP_011100389.1 PREDICTED: cysteine-rich and transmembrane domain-containing protein A-like [Sesamum indicum] Length = 77 Score = 61.2 bits (147), Expect = 3e-09 Identities = 35/66 (53%), Positives = 40/66 (60%), Gaps = 5/66 (7%) Frame = +1 Query: 121 MSSQNQSQGI-----TGSSVELLPHGGSNMATPPPPAGYPMKDGQQPDNPQNNSTTQSRG 285 MS+ Q+Q TG E P GG PPPPAGYP+KDGQQ + +TTQSRG Sbjct: 1 MSNYTQNQAAYPPPATGYPAE--PQGG--YMAPPPPAGYPVKDGQQGLDQAPAATTQSRG 56 Query: 286 DGFWKG 303 DGFWKG Sbjct: 57 DGFWKG 62 >XP_019193696.1 PREDICTED: cysteine-rich and transmembrane domain-containing protein B-like isoform X1 [Ipomoea nil] Length = 82 Score = 57.8 bits (138), Expect = 6e-08 Identities = 29/66 (43%), Positives = 36/66 (54%), Gaps = 7/66 (10%) Frame = +1 Query: 127 SQNQSQGITGSSV-------ELLPHGGSNMATPPPPAGYPMKDGQQPDNPQNNSTTQSRG 285 SQN Q G++ + P GG + P PP GYP++DGQ P + TQSRG Sbjct: 2 SQNPHQAAPGTAAFPYSQQPQPQPQGGFSAPPPLPPPGYPVRDGQGRSEPSVPAQTQSRG 61 Query: 286 DGFWKG 303 DGFWKG Sbjct: 62 DGFWKG 67 >KZV31369.1 hypothetical protein F511_05473 [Dorcoceras hygrometricum] Length = 81 Score = 57.0 bits (136), Expect = 1e-07 Identities = 31/64 (48%), Positives = 36/64 (56%), Gaps = 3/64 (4%) Frame = +1 Query: 121 MSSQNQSQGITGSSVELLP---HGGSNMATPPPPAGYPMKDGQQPDNPQNNSTTQSRGDG 291 MSS NQ Q P GG PPPPAGYP KDG++ ++TT+SRGDG Sbjct: 1 MSSHNQPQVAYPPPATAYPAETQGG--FMAPPPPAGYPTKDGREGQIQAPHATTKSRGDG 58 Query: 292 FWKG 303 FWKG Sbjct: 59 FWKG 62 >XP_019193697.1 PREDICTED: cysteine-rich and transmembrane domain-containing protein B-like isoform X2 [Ipomoea nil] Length = 81 Score = 56.6 bits (135), Expect = 2e-07 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +1 Query: 175 PHGGSNMATPPPPAGYPMKDGQQPDNPQNNSTTQSRGDGFWKG 303 P GG + P PP GYP++DGQ P + TQSRGDGFWKG Sbjct: 24 PQGGFSAPPPLPPPGYPVRDGQGRSEPSVPAQTQSRGDGFWKG 66 >XP_015074979.1 PREDICTED: cysteine-rich and transmembrane domain-containing protein A-like [Solanum pennellii] Length = 72 Score = 55.5 bits (132), Expect = 3e-07 Identities = 31/61 (50%), Positives = 35/61 (57%) Frame = +1 Query: 121 MSSQNQSQGITGSSVELLPHGGSNMATPPPPAGYPMKDGQQPDNPQNNSTTQSRGDGFWK 300 M+S NQ Q +GSS S PPPPAGYP +D Q + TTQSRGDGFWK Sbjct: 1 MNSYNQKQAESGSSQT--QQQASAFVAPPPPAGYPTRDVQSHSSVP--LTTQSRGDGFWK 56 Query: 301 G 303 G Sbjct: 57 G 57 >XP_004239248.1 PREDICTED: cysteine-rich and transmembrane domain-containing protein A-like [Solanum lycopersicum] Length = 72 Score = 55.5 bits (132), Expect = 3e-07 Identities = 31/61 (50%), Positives = 35/61 (57%) Frame = +1 Query: 121 MSSQNQSQGITGSSVELLPHGGSNMATPPPPAGYPMKDGQQPDNPQNNSTTQSRGDGFWK 300 M+S NQ Q +GSS S PPPPAGYP +D Q + TTQSRGDGFWK Sbjct: 1 MNSYNQKQAESGSSQA--QQQASAFVAPPPPAGYPTRDVQSHSSVP--LTTQSRGDGFWK 56 Query: 301 G 303 G Sbjct: 57 G 57 >XP_009785011.1 PREDICTED: cysteine-rich and transmembrane domain-containing protein A-like [Nicotiana sylvestris] XP_016474753.1 PREDICTED: cysteine-rich and transmembrane domain-containing protein A-like [Nicotiana tabacum] Length = 74 Score = 55.1 bits (131), Expect = 5e-07 Identities = 31/62 (50%), Positives = 40/62 (64%), Gaps = 1/62 (1%) Frame = +1 Query: 121 MSSQNQSQG-ITGSSVELLPHGGSNMATPPPPAGYPMKDGQQPDNPQNNSTTQSRGDGFW 297 M+S NQ+Q T + + P GG+ +A PPPPAGYP +D + + TTQSRGDGFW Sbjct: 1 MNSYNQNQAQATAYTQQQQPQGGALVA-PPPPAGYPTRDVEGDSSVP--VTTQSRGDGFW 57 Query: 298 KG 303 KG Sbjct: 58 KG 59 >XP_016559282.1 PREDICTED: cysteine-rich and transmembrane domain-containing protein A-like [Capsicum annuum] Length = 73 Score = 53.9 bits (128), Expect = 1e-06 Identities = 29/61 (47%), Positives = 38/61 (62%) Frame = +1 Query: 121 MSSQNQSQGITGSSVELLPHGGSNMATPPPPAGYPMKDGQQPDNPQNNSTTQSRGDGFWK 300 MSS NQ++ + + P G + +A PPPPAGYP +D Q + TTQS+GDGFWK Sbjct: 1 MSSYNQNEARGTAYAQQQPQGDAFVA-PPPPAGYPTRDVQGDSSAP--VTTQSKGDGFWK 57 Query: 301 G 303 G Sbjct: 58 G 58 >XP_019241385.1 PREDICTED: cysteine-rich and transmembrane domain-containing protein A-like [Nicotiana attenuata] Length = 74 Score = 53.9 bits (128), Expect = 1e-06 Identities = 30/58 (51%), Positives = 38/58 (65%) Frame = +1 Query: 130 QNQSQGITGSSVELLPHGGSNMATPPPPAGYPMKDGQQPDNPQNNSTTQSRGDGFWKG 303 QNQ+Q T + + P GG+ +A PPPPAGYP +D + + TTQSRGDGFWKG Sbjct: 6 QNQAQA-TAYTQQQQPQGGALVA-PPPPAGYPTRDVEGDSSVP--VTTQSRGDGFWKG 59 >XP_009627959.1 PREDICTED: cysteine-rich and transmembrane domain-containing protein A-like [Nicotiana tomentosiformis] XP_016500813.1 PREDICTED: cysteine-rich and transmembrane domain-containing protein A-like [Nicotiana tabacum] Length = 74 Score = 53.5 bits (127), Expect = 2e-06 Identities = 30/59 (50%), Positives = 38/59 (64%) Frame = +1 Query: 127 SQNQSQGITGSSVELLPHGGSNMATPPPPAGYPMKDGQQPDNPQNNSTTQSRGDGFWKG 303 +QNQ+Q T + P GG+ +A PPPPAGYP +D + + TTQSRGDGFWKG Sbjct: 5 NQNQAQATTYPQQQQ-PQGGALVA-PPPPAGYPTRDVEGDSSVP--VTTQSRGDGFWKG 59 >XP_006358049.1 PREDICTED: cysteine-rich and transmembrane domain-containing protein B-like [Solanum tuberosum] Length = 72 Score = 52.8 bits (125), Expect = 4e-06 Identities = 31/61 (50%), Positives = 38/61 (62%) Frame = +1 Query: 121 MSSQNQSQGITGSSVELLPHGGSNMATPPPPAGYPMKDGQQPDNPQNNSTTQSRGDGFWK 300 M+S NQ++ GSS G+ +A PPPPAGYP +D Q + TTQSRGDGFWK Sbjct: 1 MNSYNQNKA-QGSSYPAQQQAGAFVA-PPPPAGYPTRDVQGDSSVP--VTTQSRGDGFWK 56 Query: 301 G 303 G Sbjct: 57 G 57 >KCW88515.1 hypothetical protein EUGRSUZ_A00899 [Eucalyptus grandis] Length = 73 Score = 52.4 bits (124), Expect = 5e-06 Identities = 25/44 (56%), Positives = 28/44 (63%), Gaps = 1/44 (2%) Frame = +1 Query: 175 PHGGSNMA-TPPPPAGYPMKDGQQPDNPQNNSTTQSRGDGFWKG 303 P S MA PPP GYPM+DGQQP T++RGDGFWKG Sbjct: 15 PPPASTMAYVAPPPPGYPMRDGQQPAQNAVPIETKTRGDGFWKG 58 >XP_010044693.1 PREDICTED: cysteine-rich and transmembrane domain-containing protein B [Eucalyptus grandis] KCW88516.1 hypothetical protein EUGRSUZ_A00900 [Eucalyptus grandis] Length = 76 Score = 52.0 bits (123), Expect = 8e-06 Identities = 25/47 (53%), Positives = 29/47 (61%), Gaps = 4/47 (8%) Frame = +1 Query: 175 PHGGSNMAT----PPPPAGYPMKDGQQPDNPQNNSTTQSRGDGFWKG 303 P S +AT PPPPAGYP +DG QP T++RGDGFWKG Sbjct: 15 PPPASALATTYTAPPPPAGYPTRDGPQPAQKAVPIETKTRGDGFWKG 61 >KHN26827.1 hypothetical protein glysoja_011419 [Glycine soja] Length = 71 Score = 51.6 bits (122), Expect = 9e-06 Identities = 29/62 (46%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = +1 Query: 121 MSSQNQSQGITGSSVELLPHGG-SNMATPPPPAGYPMKDGQQPDNPQNNSTTQSRGDGFW 297 M+ Q QS +T P G SN+A PPPP GYP KD P T +RGDGFW Sbjct: 1 MNHQQQSPAVTA-----YPAGAQSNLAAPPPPVGYPTKD-DLPSQQNVPVKTTTRGDGFW 54 Query: 298 KG 303 KG Sbjct: 55 KG 56