BLASTX nr result
ID: Lithospermum23_contig00006107
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00006107 (1202 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010655736.1 PREDICTED: nuclear transcription factor Y subunit... 61 3e-07 >XP_010655736.1 PREDICTED: nuclear transcription factor Y subunit A-7 [Vitis vinifera] CBI30998.3 unnamed protein product, partial [Vitis vinifera] Length = 208 Score = 61.2 bits (147), Expect = 3e-07 Identities = 35/69 (50%), Positives = 42/69 (60%), Gaps = 1/69 (1%) Frame = +3 Query: 999 MTSSAPEVSGSSHDNGEDVEQHQDQGTQAQSSAMETGVS-PGTVAPNFPYVTPPQLGADN 1175 MTSS ++S DN E E + Q QSS+ G S PG+ A N PY TPPQLGA + Sbjct: 1 MTSSVHDLS----DNSEADEPQKHSELQVQSSSPAAGASHPGSAAANIPYATPPQLGAGH 56 Query: 1176 AMAAAAFPY 1202 AMA AA+PY Sbjct: 57 AMAQAAYPY 65