BLASTX nr result
ID: Lithospermum23_contig00005404
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00005404 (254 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAD94961.1 aquaporin, partial [Arabidopsis thaliana] 51 6e-07 BAF44223.1 aquaporin [Iris x hollandica] 55 8e-07 BAD93962.1 water channel - like protein, partial [Arabidopsis th... 50 1e-06 BAV00119.1 plasma membrane intrinsic protein [Dianthus caryophyl... 54 2e-06 AAR23268.1 PIP1;2 [Spinacia oleracea] KNA10586.1 hypothetical pr... 54 2e-06 AAB67870.1 plasma membrane major intrinsic protein 3 [Beta vulga... 54 2e-06 KMT18241.1 hypothetical protein BVRB_2g024080 [Beta vulgaris sub... 54 2e-06 NP_001290008.1 probable aquaporin PIP1-4 [Beta vulgaris subsp. v... 54 2e-06 AAT39557.1 PIP1 aquaporin, partial [Xerophyta humilis] 50 2e-06 XP_009367837.1 PREDICTED: probable aquaporin PIP1-2 [Pyrus x bre... 50 2e-06 XP_017418201.1 PREDICTED: aquaporin PIP1-3-like [Vigna angularis... 50 3e-06 XP_019578011.1 PREDICTED: probable aquaporin PIP1-4 [Rhinolophus... 53 3e-06 ABR25793.1 aquaporin pip1.2, partial [Oryza sativa Indica Group] 51 3e-06 AAP94015.1 putative transmembrane protein, partial [Pringlea ant... 50 3e-06 XP_020104102.1 aquaporin PIP1-3-like [Ananas comosus] 50 4e-06 AAA93521.1 aquaporin [Mesembryanthemum crystallinum] 53 4e-06 JAU20952.1 putative aquaporin PIP1-4 [Noccaea caerulescens] 53 4e-06 XP_013612790.1 PREDICTED: probable aquaporin PIP1-4 [Brassica ol... 53 4e-06 CDY51161.1 BnaA09g51960D [Brassica napus] 53 4e-06 AJT55762.1 aquaporin plasma intrinsic protein 1 [Allium sativum] 53 4e-06 >BAD94961.1 aquaporin, partial [Arabidopsis thaliana] Length = 40 Score = 50.8 bits (120), Expect = 6e-07 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = +2 Query: 2 WVGPFIGAALAAVYHTIVIRAMPFK 76 WVGPFIGAALAA+YH IVIRA+PFK Sbjct: 13 WVGPFIGAALAALYHVIVIRAIPFK 37 >BAF44223.1 aquaporin [Iris x hollandica] Length = 327 Score = 54.7 bits (130), Expect = 8e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 2 WVGPFIGAALAAVYHTIVIRAMPFKRT*IKLF 97 WVGPFIGAALAA+YH IVIRA+PFK +KLF Sbjct: 262 WVGPFIGAALAAMYHQIVIRAIPFKSRSLKLF 293 >BAD93962.1 water channel - like protein, partial [Arabidopsis thaliana] Length = 55 Score = 50.4 bits (119), Expect = 1e-06 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = +2 Query: 2 WVGPFIGAALAAVYHTIVIRAMPFK 76 WVGPFIGAALAA+YH IVIRA+PFK Sbjct: 28 WVGPFIGAALAALYHQIVIRAIPFK 52 >BAV00119.1 plasma membrane intrinsic protein [Dianthus caryophyllus] Length = 285 Score = 53.5 bits (127), Expect = 2e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +2 Query: 2 WVGPFIGAALAAVYHTIVIRAMPFK 76 WVGPFIGAALAAVYHT+VIRA+PFK Sbjct: 258 WVGPFIGAALAAVYHTVVIRAIPFK 282 >AAR23268.1 PIP1;2 [Spinacia oleracea] KNA10586.1 hypothetical protein SOVF_142990 [Spinacia oleracea] Length = 285 Score = 53.5 bits (127), Expect = 2e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +2 Query: 2 WVGPFIGAALAAVYHTIVIRAMPFK 76 WVGPFIGAALAAVYHT+VIRA+PFK Sbjct: 259 WVGPFIGAALAAVYHTVVIRAIPFK 283 >AAB67870.1 plasma membrane major intrinsic protein 3 [Beta vulgaris] Length = 286 Score = 53.5 bits (127), Expect = 2e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +2 Query: 2 WVGPFIGAALAAVYHTIVIRAMPFK 76 WVGPFIGAALAAVYHT+VIRA+PFK Sbjct: 259 WVGPFIGAALAAVYHTVVIRAIPFK 283 >KMT18241.1 hypothetical protein BVRB_2g024080 [Beta vulgaris subsp. vulgaris] Length = 286 Score = 53.5 bits (127), Expect = 2e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +2 Query: 2 WVGPFIGAALAAVYHTIVIRAMPFK 76 WVGPFIGAALAAVYHT+VIRA+PFK Sbjct: 259 WVGPFIGAALAAVYHTVVIRAIPFK 283 >NP_001290008.1 probable aquaporin PIP1-4 [Beta vulgaris subsp. vulgaris] ACT22629.1 plasma membrane intrinsic protein PIP1;1 [Beta vulgaris subsp. vulgaris] Length = 286 Score = 53.5 bits (127), Expect = 2e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +2 Query: 2 WVGPFIGAALAAVYHTIVIRAMPFK 76 WVGPFIGAALAAVYHT+VIRA+PFK Sbjct: 259 WVGPFIGAALAAVYHTVVIRAIPFK 283 >AAT39557.1 PIP1 aquaporin, partial [Xerophyta humilis] Length = 62 Score = 50.1 bits (118), Expect = 2e-06 Identities = 21/25 (84%), Positives = 24/25 (96%) Frame = +2 Query: 2 WVGPFIGAALAAVYHTIVIRAMPFK 76 WVGPFIGAALAA+YH +VIRA+PFK Sbjct: 35 WVGPFIGAALAALYHQVVIRAIPFK 59 >XP_009367837.1 PREDICTED: probable aquaporin PIP1-2 [Pyrus x bretschneideri] Length = 82 Score = 50.4 bits (119), Expect = 2e-06 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = +2 Query: 2 WVGPFIGAALAAVYHTIVIRAMPFK 76 WVGPFIGAALAA+YH IVIRA+PFK Sbjct: 55 WVGPFIGAALAALYHQIVIRAIPFK 79 >XP_017418201.1 PREDICTED: aquaporin PIP1-3-like [Vigna angularis] BAT86125.1 hypothetical protein VIGAN_04374700 [Vigna angularis var. angularis] Length = 87 Score = 50.4 bits (119), Expect = 3e-06 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = +2 Query: 2 WVGPFIGAALAAVYHTIVIRAMPFK 76 WVGPFIGAALAA+YH IVIRA+PFK Sbjct: 60 WVGPFIGAALAALYHQIVIRAIPFK 84 >XP_019578011.1 PREDICTED: probable aquaporin PIP1-4 [Rhinolophus sinicus] Length = 286 Score = 53.1 bits (126), Expect = 3e-06 Identities = 22/25 (88%), Positives = 25/25 (100%) Frame = +2 Query: 2 WVGPFIGAALAAVYHTIVIRAMPFK 76 WVGPF+GAALAA+YHTIVIRA+PFK Sbjct: 259 WVGPFVGAALAAIYHTIVIRAIPFK 283 >ABR25793.1 aquaporin pip1.2, partial [Oryza sativa Indica Group] Length = 109 Score = 50.8 bits (120), Expect = 3e-06 Identities = 21/25 (84%), Positives = 24/25 (96%) Frame = +2 Query: 2 WVGPFIGAALAAVYHTIVIRAMPFK 76 WVGPFIGAALAA+YH +VIRA+PFK Sbjct: 82 WVGPFIGAALAAIYHQVVIRAIPFK 106 >AAP94015.1 putative transmembrane protein, partial [Pringlea antiscorbutica] Length = 98 Score = 50.4 bits (119), Expect = 3e-06 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = +2 Query: 2 WVGPFIGAALAAVYHTIVIRAMPFK 76 WVGPFIGAALAA+YH IVIRA+PFK Sbjct: 71 WVGPFIGAALAALYHQIVIRAIPFK 95 >XP_020104102.1 aquaporin PIP1-3-like [Ananas comosus] Length = 86 Score = 50.1 bits (118), Expect = 4e-06 Identities = 21/25 (84%), Positives = 24/25 (96%) Frame = +2 Query: 2 WVGPFIGAALAAVYHTIVIRAMPFK 76 WVGPFIGAALAA+YH +VIRA+PFK Sbjct: 59 WVGPFIGAALAAMYHQVVIRAIPFK 83 >AAA93521.1 aquaporin [Mesembryanthemum crystallinum] Length = 285 Score = 52.8 bits (125), Expect = 4e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +2 Query: 2 WVGPFIGAALAAVYHTIVIRAMPFK 76 WVGPFIGAALAA+YHTIVIRA+PFK Sbjct: 258 WVGPFIGAALAALYHTIVIRAIPFK 282 >JAU20952.1 putative aquaporin PIP1-4 [Noccaea caerulescens] Length = 286 Score = 52.8 bits (125), Expect = 4e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +2 Query: 2 WVGPFIGAALAAVYHTIVIRAMPFK 76 WVGPFIGAALAA+YHTIVIRA+PFK Sbjct: 259 WVGPFIGAALAALYHTIVIRAIPFK 283 >XP_013612790.1 PREDICTED: probable aquaporin PIP1-4 [Brassica oleracea var. oleracea] CDY07221.1 BnaCnng02360D [Brassica napus] Length = 286 Score = 52.8 bits (125), Expect = 4e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +2 Query: 2 WVGPFIGAALAAVYHTIVIRAMPFK 76 WVGPFIGAALAA+YHTIVIRA+PFK Sbjct: 259 WVGPFIGAALAALYHTIVIRAIPFK 283 >CDY51161.1 BnaA09g51960D [Brassica napus] Length = 286 Score = 52.8 bits (125), Expect = 4e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +2 Query: 2 WVGPFIGAALAAVYHTIVIRAMPFK 76 WVGPFIGAALAA+YHTIVIRA+PFK Sbjct: 259 WVGPFIGAALAALYHTIVIRAIPFK 283 >AJT55762.1 aquaporin plasma intrinsic protein 1 [Allium sativum] Length = 288 Score = 52.8 bits (125), Expect = 4e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +2 Query: 2 WVGPFIGAALAAVYHTIVIRAMPFK 76 WVGPFIGAALAA+YHTIVIRA+PFK Sbjct: 261 WVGPFIGAALAAMYHTIVIRAIPFK 285