BLASTX nr result
ID: Lithospermum23_contig00005390
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00005390 (221 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAU83985.1 NAC domain-containing protein 19, partial [Noccaea ca... 66 4e-12 AIM47115.1 putative NAC transcription factor [Suaeda liaotungensis] 69 5e-12 XP_019577799.1 PREDICTED: NAC domain-containing protein 72 [Rhin... 67 1e-11 CDY26031.1 BnaC06g05930D [Brassica napus] 64 3e-11 XP_019449146.1 PREDICTED: NAC domain-containing protein 72-like ... 67 3e-11 XP_014491333.1 PREDICTED: NAC domain-containing protein 72-like ... 67 3e-11 XP_017433508.1 PREDICTED: NAC domain-containing protein 72-like ... 67 3e-11 BAT89593.1 hypothetical protein VIGAN_06058200 [Vigna angularis ... 67 3e-11 XP_010675611.1 PREDICTED: NAC domain-containing protein 72 [Beta... 67 3e-11 CDY26032.1 BnaC06g05920D [Brassica napus] 64 3e-11 NP_567773.1 NAC (No Apical Meristem) domain transcriptional regu... 66 3e-11 XP_018447063.1 PREDICTED: NAC domain-containing protein 72-like ... 66 3e-11 XP_010433374.1 PREDICTED: NAC domain-containing protein 72 [Came... 66 3e-11 XP_013671595.1 PREDICTED: NAC domain-containing protein 72-like ... 66 3e-11 NP_001302512.1 NAC domain-containing protein 72-like [Brassica n... 66 3e-11 AAP35056.1 NAC-domain protein 485 [Brassica napus] 66 3e-11 XP_010448140.1 PREDICTED: NAC domain-containing protein 72 [Came... 66 3e-11 XP_010438620.1 PREDICTED: NAC domain-containing protein 72-like ... 66 3e-11 XP_006284199.1 hypothetical protein CARUB_v10005353mg [Capsella ... 66 3e-11 XP_010520901.1 PREDICTED: NAC domain-containing protein 72 [Tare... 66 3e-11 >JAU83985.1 NAC domain-containing protein 19, partial [Noccaea caerulescens] Length = 146 Score = 66.2 bits (160), Expect = 4e-12 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +2 Query: 122 KMGVQEKDPLAQLSLPPGFRFFPTDEELLVQYL 220 KMG+QE DPLAQLSLPPGFRF+PTDEEL+VQYL Sbjct: 1 KMGIQETDPLAQLSLPPGFRFYPTDEELMVQYL 33 >AIM47115.1 putative NAC transcription factor [Suaeda liaotungensis] Length = 369 Score = 68.9 bits (167), Expect = 5e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 125 MGVQEKDPLAQLSLPPGFRFFPTDEELLVQYL 220 MGVQEKDPLAQLSLPPGFRFFPTDEELLVQYL Sbjct: 1 MGVQEKDPLAQLSLPPGFRFFPTDEELLVQYL 32 >XP_019577799.1 PREDICTED: NAC domain-containing protein 72 [Rhinolophus sinicus] Length = 309 Score = 67.4 bits (163), Expect = 1e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 125 MGVQEKDPLAQLSLPPGFRFFPTDEELLVQYL 220 MGV+EKDPLAQLSLPPGFRFFPTDEELLVQYL Sbjct: 1 MGVREKDPLAQLSLPPGFRFFPTDEELLVQYL 32 >CDY26031.1 BnaC06g05930D [Brassica napus] Length = 151 Score = 64.3 bits (155), Expect = 3e-11 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +2 Query: 125 MGVQEKDPLAQLSLPPGFRFFPTDEELLVQYL 220 MG+QE DPLAQLSLPPGFRF+PTDEEL+VQYL Sbjct: 1 MGIQETDPLAQLSLPPGFRFYPTDEELMVQYL 32 >XP_019449146.1 PREDICTED: NAC domain-containing protein 72-like [Lupinus angustifolius] OIW08261.1 hypothetical protein TanjilG_21727 [Lupinus angustifolius] Length = 327 Score = 66.6 bits (161), Expect = 3e-11 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 125 MGVQEKDPLAQLSLPPGFRFFPTDEELLVQYL 220 MGV EKDPLAQLSLPPGFRFFPTDEELLVQYL Sbjct: 1 MGVPEKDPLAQLSLPPGFRFFPTDEELLVQYL 32 >XP_014491333.1 PREDICTED: NAC domain-containing protein 72-like [Vigna radiata var. radiata] Length = 336 Score = 66.6 bits (161), Expect = 3e-11 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 125 MGVQEKDPLAQLSLPPGFRFFPTDEELLVQYL 220 MGVQE+DPLAQLSLPPGFRF+PTDEELLVQYL Sbjct: 1 MGVQERDPLAQLSLPPGFRFYPTDEELLVQYL 32 >XP_017433508.1 PREDICTED: NAC domain-containing protein 72-like [Vigna angularis] KOM49611.1 hypothetical protein LR48_Vigan08g043800 [Vigna angularis] Length = 336 Score = 66.6 bits (161), Expect = 3e-11 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 125 MGVQEKDPLAQLSLPPGFRFFPTDEELLVQYL 220 MGVQE+DPLAQLSLPPGFRF+PTDEELLVQYL Sbjct: 1 MGVQERDPLAQLSLPPGFRFYPTDEELLVQYL 32 >BAT89593.1 hypothetical protein VIGAN_06058200 [Vigna angularis var. angularis] Length = 352 Score = 66.6 bits (161), Expect = 3e-11 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 125 MGVQEKDPLAQLSLPPGFRFFPTDEELLVQYL 220 MGVQE+DPLAQLSLPPGFRF+PTDEELLVQYL Sbjct: 1 MGVQERDPLAQLSLPPGFRFYPTDEELLVQYL 32 >XP_010675611.1 PREDICTED: NAC domain-containing protein 72 [Beta vulgaris subsp. vulgaris] KMT13029.1 hypothetical protein BVRB_4g087440 [Beta vulgaris subsp. vulgaris] Length = 364 Score = 66.6 bits (161), Expect = 3e-11 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 125 MGVQEKDPLAQLSLPPGFRFFPTDEELLVQYL 220 MGVQ+KDPLAQLSLPPGFRF+PTDEELLVQYL Sbjct: 1 MGVQDKDPLAQLSLPPGFRFYPTDEELLVQYL 32 >CDY26032.1 BnaC06g05920D [Brassica napus] Length = 161 Score = 64.3 bits (155), Expect = 3e-11 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +2 Query: 125 MGVQEKDPLAQLSLPPGFRFFPTDEELLVQYL 220 MG+QE DPLAQLSLPPGFRF+PTDEEL+VQYL Sbjct: 1 MGIQETDPLAQLSLPPGFRFYPTDEELMVQYL 32 >NP_567773.1 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein [Arabidopsis thaliana] Q93VY3.1 RecName: Full=NAC domain-containing protein 72; Short=ANAC072; AltName: Full=Protein RESPONSIVE TO DESICCATION 26 AAL16305.1 AT4g27410/F27G19_10 [Arabidopsis thaliana] AAL09817.1 unknown protein [Arabidopsis thaliana] AAM14367.1 unknown protein [Arabidopsis thaliana] AAM65308.1 unknown [Arabidopsis thaliana] AAN60296.1 unknown [Arabidopsis thaliana] AEE85334.1 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein [Arabidopsis thaliana] Length = 297 Score = 66.2 bits (160), Expect = 3e-11 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 125 MGVQEKDPLAQLSLPPGFRFFPTDEELLVQYL 220 MGV+EKDPLAQLSLPPGFRF+PTDEELLVQYL Sbjct: 1 MGVREKDPLAQLSLPPGFRFYPTDEELLVQYL 32 >XP_018447063.1 PREDICTED: NAC domain-containing protein 72-like [Raphanus sativus] Length = 299 Score = 66.2 bits (160), Expect = 3e-11 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 125 MGVQEKDPLAQLSLPPGFRFFPTDEELLVQYL 220 MGV+EKDPLAQLSLPPGFRF+PTDEELLVQYL Sbjct: 1 MGVREKDPLAQLSLPPGFRFYPTDEELLVQYL 32 >XP_010433374.1 PREDICTED: NAC domain-containing protein 72 [Camelina sativa] Length = 300 Score = 66.2 bits (160), Expect = 3e-11 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 125 MGVQEKDPLAQLSLPPGFRFFPTDEELLVQYL 220 MGV+EKDPLAQLSLPPGFRF+PTDEELLVQYL Sbjct: 1 MGVREKDPLAQLSLPPGFRFYPTDEELLVQYL 32 >XP_013671595.1 PREDICTED: NAC domain-containing protein 72-like isoform X1 [Brassica napus] CDY29303.1 BnaC01g19550D [Brassica napus] Length = 300 Score = 66.2 bits (160), Expect = 3e-11 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 125 MGVQEKDPLAQLSLPPGFRFFPTDEELLVQYL 220 MGV+EKDPLAQLSLPPGFRF+PTDEELLVQYL Sbjct: 1 MGVREKDPLAQLSLPPGFRFYPTDEELLVQYL 32 >NP_001302512.1 NAC domain-containing protein 72-like [Brassica napus] XP_009143398.1 PREDICTED: NAC domain-containing protein 72-like [Brassica rapa] AHN60144.1 NAC transcription factor 72 [Brassica napus] CDX89253.1 BnaA01g16400D [Brassica napus] Length = 300 Score = 66.2 bits (160), Expect = 3e-11 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 125 MGVQEKDPLAQLSLPPGFRFFPTDEELLVQYL 220 MGV+EKDPLAQLSLPPGFRF+PTDEELLVQYL Sbjct: 1 MGVREKDPLAQLSLPPGFRFYPTDEELLVQYL 32 >AAP35056.1 NAC-domain protein 485 [Brassica napus] Length = 300 Score = 66.2 bits (160), Expect = 3e-11 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 125 MGVQEKDPLAQLSLPPGFRFFPTDEELLVQYL 220 MGV+EKDPLAQLSLPPGFRF+PTDEELLVQYL Sbjct: 1 MGVREKDPLAQLSLPPGFRFYPTDEELLVQYL 32 >XP_010448140.1 PREDICTED: NAC domain-containing protein 72 [Camelina sativa] Length = 301 Score = 66.2 bits (160), Expect = 3e-11 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 125 MGVQEKDPLAQLSLPPGFRFFPTDEELLVQYL 220 MGV+EKDPLAQLSLPPGFRF+PTDEELLVQYL Sbjct: 1 MGVREKDPLAQLSLPPGFRFYPTDEELLVQYL 32 >XP_010438620.1 PREDICTED: NAC domain-containing protein 72-like [Camelina sativa] Length = 301 Score = 66.2 bits (160), Expect = 3e-11 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 125 MGVQEKDPLAQLSLPPGFRFFPTDEELLVQYL 220 MGV+EKDPLAQLSLPPGFRF+PTDEELLVQYL Sbjct: 1 MGVREKDPLAQLSLPPGFRFYPTDEELLVQYL 32 >XP_006284199.1 hypothetical protein CARUB_v10005353mg [Capsella rubella] EOA17097.1 hypothetical protein CARUB_v10005353mg [Capsella rubella] Length = 302 Score = 66.2 bits (160), Expect = 3e-11 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 125 MGVQEKDPLAQLSLPPGFRFFPTDEELLVQYL 220 MGV+EKDPLAQLSLPPGFRF+PTDEELLVQYL Sbjct: 1 MGVREKDPLAQLSLPPGFRFYPTDEELLVQYL 32 >XP_010520901.1 PREDICTED: NAC domain-containing protein 72 [Tarenaya hassleriana] Length = 304 Score = 66.2 bits (160), Expect = 3e-11 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 125 MGVQEKDPLAQLSLPPGFRFFPTDEELLVQYL 220 MGV+EKDPLAQLSLPPGFRF+PTDEELLVQYL Sbjct: 1 MGVREKDPLAQLSLPPGFRFYPTDEELLVQYL 32