BLASTX nr result
ID: Lithospermum23_contig00005371
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00005371 (549 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012848568.1 PREDICTED: pollen-specific leucine-rich repeat ex... 64 4e-09 XP_011095916.1 PREDICTED: pollen-specific leucine-rich repeat ex... 64 6e-09 CDP04524.1 unnamed protein product [Coffea canephora] 60 1e-08 CDP21271.1 unnamed protein product [Coffea canephora] 60 2e-08 KVI01094.1 RNA polymerase Rpb1, domain 5, partial [Cynara cardun... 62 3e-08 XP_018623835.1 PREDICTED: protein PYRICULARIA ORYZAE RESISTANCE ... 61 3e-08 KVG33796.1 hypothetical protein Ccrd_026488 [Cynara cardunculus ... 62 5e-08 XP_009591786.1 PREDICTED: protein PYRICULARIA ORYZAE RESISTANCE ... 61 5e-08 XP_006350257.1 PREDICTED: neurofilament heavy polypeptide-like [... 61 6e-08 XP_011086262.1 PREDICTED: pollen-specific leucine-rich repeat ex... 61 8e-08 XP_015071626.1 PREDICTED: translation initiation factor IF-2-lik... 60 9e-08 XP_004236656.1 PREDICTED: neurofilament heavy polypeptide [Solan... 60 9e-08 XP_019223786.1 PREDICTED: neurofilament medium polypeptide-like ... 60 1e-07 XP_016447112.1 PREDICTED: pollen-specific leucine-rich repeat ex... 60 1e-07 XP_009613311.1 PREDICTED: pollen-specific leucine-rich repeat ex... 60 1e-07 XP_015056860.1 PREDICTED: pollen-specific leucine-rich repeat ex... 60 2e-07 XP_015056859.1 PREDICTED: pollen-specific leucine-rich repeat ex... 60 2e-07 XP_004250292.1 PREDICTED: pollen-specific leucine-rich repeat ex... 60 2e-07 XP_009796355.1 PREDICTED: uncharacterized protein LOC104242939 [... 59 2e-07 XP_015166381.1 PREDICTED: uncharacterized protein LOC102600600 i... 59 2e-07 >XP_012848568.1 PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 1 [Erythranthe guttata] EYU27661.1 hypothetical protein MIMGU_mgv1a012649mg [Erythranthe guttata] Length = 244 Score = 63.9 bits (154), Expect = 4e-09 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +3 Query: 213 AEKTTIMVIKVDLQCPCCYKKIKRILCKFPR 305 AEK T+MV+KVDLQCPCCYKK+K+ILCKFP+ Sbjct: 2 AEKVTVMVLKVDLQCPCCYKKVKKILCKFPQ 32 >XP_011095916.1 PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 1 [Sesamum indicum] Length = 275 Score = 63.9 bits (154), Expect = 6e-09 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +3 Query: 213 AEKTTIMVIKVDLQCPCCYKKIKRILCKFPR 305 AEK T+MV+KVDLQCPCCYKK+K+ILCKFP+ Sbjct: 2 AEKVTVMVLKVDLQCPCCYKKVKKILCKFPQ 32 >CDP04524.1 unnamed protein product [Coffea canephora] Length = 102 Score = 59.7 bits (143), Expect = 1e-08 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +3 Query: 213 AEKTTIMVIKVDLQCPCCYKKIKRILCKFPR 305 AEK T M +KVDLQCPCCYKK+K+ILCKFP+ Sbjct: 2 AEKVTTMRLKVDLQCPCCYKKVKKILCKFPQ 32 >CDP21271.1 unnamed protein product [Coffea canephora] Length = 116 Score = 59.7 bits (143), Expect = 2e-08 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +3 Query: 213 AEKTTIMVIKVDLQCPCCYKKIKRILCKFPR 305 AEK T M +KVDLQCPCCYKK+K+ILCKFP+ Sbjct: 2 AEKVTTMRLKVDLQCPCCYKKVKKILCKFPQ 32 >KVI01094.1 RNA polymerase Rpb1, domain 5, partial [Cynara cardunculus var. scolymus] Length = 414 Score = 62.4 bits (150), Expect = 3e-08 Identities = 28/65 (43%), Positives = 41/65 (63%) Frame = +3 Query: 207 MAAEKTTIMVIKVDLQCPCCYKKIKRILCKFPRELPIPS*LVSYYKYTHQLIPMYLMLNF 386 MA +K T+M++ VDL+C CCYKK+K++LCKFPR+ P S +S L P + Sbjct: 1 MAPDKVTVMILNVDLKCSCCYKKVKKLLCKFPRQFPSLSLSLSL------LFPFGFLSKS 54 Query: 387 LAHDN 401 + HD+ Sbjct: 55 IIHDH 59 >XP_018623835.1 PREDICTED: protein PYRICULARIA ORYZAE RESISTANCE 21-like isoform X2 [Nicotiana tomentosiformis] Length = 224 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +3 Query: 216 EKTTIMVIKVDLQCPCCYKKIKRILCKFPR 305 EKTTIMV+KVDLQC CCYKK+K++LCKFP+ Sbjct: 7 EKTTIMVLKVDLQCSCCYKKVKKVLCKFPQ 36 >KVG33796.1 hypothetical protein Ccrd_026488 [Cynara cardunculus var. scolymus] Length = 310 Score = 61.6 bits (148), Expect = 5e-08 Identities = 22/36 (61%), Positives = 31/36 (86%) Frame = +3 Query: 207 MAAEKTTIMVIKVDLQCPCCYKKIKRILCKFPRELP 314 MA +K T+M++ VDL+C CCYKK+K++LCKFPR+ P Sbjct: 1 MAPDKVTVMILNVDLKCSCCYKKVKKLLCKFPRQFP 36 >XP_009591786.1 PREDICTED: protein PYRICULARIA ORYZAE RESISTANCE 21-like isoform X1 [Nicotiana tomentosiformis] Length = 262 Score = 61.2 bits (147), Expect = 5e-08 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +3 Query: 216 EKTTIMVIKVDLQCPCCYKKIKRILCKFPR 305 EKTTIMV+KVDLQC CCYKK+K++LCKFP+ Sbjct: 7 EKTTIMVLKVDLQCSCCYKKVKKVLCKFPQ 36 >XP_006350257.1 PREDICTED: neurofilament heavy polypeptide-like [Solanum tuberosum] Length = 260 Score = 60.8 bits (146), Expect = 6e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 216 EKTTIMVIKVDLQCPCCYKKIKRILCKFPR 305 EKTTIMV+KVDLQCPCCYKK K+ILCK P+ Sbjct: 7 EKTTIMVLKVDLQCPCCYKKAKKILCKMPQ 36 >XP_011086262.1 PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 1 [Sesamum indicum] Length = 282 Score = 60.8 bits (146), Expect = 8e-08 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 207 MAAEKTTIMVIKVDLQCPCCYKKIKRILCKFPR 305 MA EK T MV++VDLQCPCCYKKIK+ LCKFP+ Sbjct: 1 MAVEKVTPMVLRVDLQCPCCYKKIKKTLCKFPQ 33 >XP_015071626.1 PREDICTED: translation initiation factor IF-2-like isoform X1 [Solanum pennellii] Length = 264 Score = 60.5 bits (145), Expect = 9e-08 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 216 EKTTIMVIKVDLQCPCCYKKIKRILCKFPR 305 EKTT+MV+KVDLQCPCCYKK K+ILCK P+ Sbjct: 7 EKTTVMVLKVDLQCPCCYKKAKKILCKMPQ 36 >XP_004236656.1 PREDICTED: neurofilament heavy polypeptide [Solanum lycopersicum] Length = 266 Score = 60.5 bits (145), Expect = 9e-08 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 216 EKTTIMVIKVDLQCPCCYKKIKRILCKFPR 305 EKTT+MV+KVDLQCPCCYKK K+ILCK P+ Sbjct: 7 EKTTVMVLKVDLQCPCCYKKAKKILCKMPQ 36 >XP_019223786.1 PREDICTED: neurofilament medium polypeptide-like [Nicotiana attenuata] OIT05741.1 hypothetical protein A4A49_02284 [Nicotiana attenuata] Length = 276 Score = 60.5 bits (145), Expect = 1e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 216 EKTTIMVIKVDLQCPCCYKKIKRILCKFPR 305 EKTTIMV+KVDLQCPCCYKK K++LCK P+ Sbjct: 7 EKTTIMVLKVDLQCPCCYKKAKKVLCKMPQ 36 >XP_016447112.1 PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 1 [Nicotiana tabacum] Length = 278 Score = 60.1 bits (144), Expect = 1e-07 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = +3 Query: 216 EKTTIMVIKVDLQCPCCYKKIKRILCKFPR 305 EKTT+MV+KVDLQCPCCYKK K++LCK P+ Sbjct: 7 EKTTVMVLKVDLQCPCCYKKAKKVLCKMPQ 36 >XP_009613311.1 PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 2 [Nicotiana tomentosiformis] Length = 278 Score = 60.1 bits (144), Expect = 1e-07 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = +3 Query: 216 EKTTIMVIKVDLQCPCCYKKIKRILCKFPR 305 EKTT+MV+KVDLQCPCCYKK K++LCK P+ Sbjct: 7 EKTTVMVLKVDLQCPCCYKKAKKVLCKMPQ 36 >XP_015056860.1 PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 1 isoform X2 [Solanum pennellii] Length = 269 Score = 59.7 bits (143), Expect = 2e-07 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 207 MAAEKTTIMVIKVDLQCPCCYKKIKRILCKFPR 305 M EKTTIMV+KVDLQC CYKK+K+ILCKFP+ Sbjct: 1 MGGEKTTIMVLKVDLQCSSCYKKVKKILCKFPQ 33 >XP_015056859.1 PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 1 isoform X1 [Solanum pennellii] Length = 282 Score = 59.7 bits (143), Expect = 2e-07 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 207 MAAEKTTIMVIKVDLQCPCCYKKIKRILCKFPR 305 M EKTTIMV+KVDLQC CYKK+K+ILCKFP+ Sbjct: 1 MGGEKTTIMVLKVDLQCSSCYKKVKKILCKFPQ 33 >XP_004250292.1 PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 1 [Solanum lycopersicum] Length = 296 Score = 59.7 bits (143), Expect = 2e-07 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 207 MAAEKTTIMVIKVDLQCPCCYKKIKRILCKFPR 305 M EKTTIMV+KVDLQC CYKK+K+ILCKFP+ Sbjct: 1 MGGEKTTIMVLKVDLQCSSCYKKVKKILCKFPQ 33 >XP_009796355.1 PREDICTED: uncharacterized protein LOC104242939 [Nicotiana sylvestris] Length = 201 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = +3 Query: 216 EKTTIMVIKVDLQCPCCYKKIKRILCKFPR 305 EKTT MV+KVDLQC CCYKK+K++LCKFP+ Sbjct: 7 EKTTKMVLKVDLQCSCCYKKVKKVLCKFPQ 36 >XP_015166381.1 PREDICTED: uncharacterized protein LOC102600600 isoform X1 [Solanum tuberosum] Length = 202 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +3 Query: 207 MAAEKTTIMVIKVDLQCPCCYKKIKRILCKFPR 305 M EKT IMV+KVDLQC CYKK+K+ILCKFPR Sbjct: 1 MGGEKTAIMVLKVDLQCSNCYKKVKKILCKFPR 33