BLASTX nr result
ID: Lithospermum23_contig00004608
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00004608 (371 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010527883.1 PREDICTED: uncharacterized protein LOC104805146 [... 54 4e-06 >XP_010527883.1 PREDICTED: uncharacterized protein LOC104805146 [Tarenaya hassleriana] Length = 474 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = +1 Query: 265 MKNMKKTRNDKNSEAPKQKERHIVSWTSEEDDILR 369 M+ MKK RN N+E K+KERHIV+WT EEDDILR Sbjct: 1 MQEMKKKRNGNNNEESKKKERHIVTWTQEEDDILR 35