BLASTX nr result
ID: Lithospermum23_contig00004518
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00004518 (362 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABB55329.1 hypothetical protein 12.t00047 [Asparagus officinalis] 72 1e-12 ABB55324.1 hypothetical protein 12.t00041 [Asparagus officinalis] 61 4e-09 XP_013443334.1 hypothetical protein MTR_0020s0050 [Medicago trun... 57 1e-07 ABD63123.1 hypothetical protein 18.t00019 [Asparagus officinalis] 54 2e-06 XP_003621188.1 hypothetical protein MTR_7g010230 [Medicago trunc... 49 1e-05 >ABB55329.1 hypothetical protein 12.t00047 [Asparagus officinalis] Length = 304 Score = 72.4 bits (176), Expect = 1e-12 Identities = 33/40 (82%), Positives = 36/40 (90%), Gaps = 1/40 (2%) Frame = -1 Query: 203 VGYYNLPHLNSQRPR*STT-HPRPYHPCEILEVAPTASRG 87 +GYY LPHLNSQRPR + + HPRPYHPCEILEVAPTASRG Sbjct: 253 LGYYKLPHLNSQRPRYAKSYHPRPYHPCEILEVAPTASRG 292 >ABB55324.1 hypothetical protein 12.t00041 [Asparagus officinalis] Length = 180 Score = 61.2 bits (147), Expect = 4e-09 Identities = 45/110 (40%), Positives = 51/110 (46%) Frame = +2 Query: 32 AKPSGTVGTKCYAAQSAGHLLRP*EPPLESHTDGTVLDVLWINEDVENLSGGGCNTRPKN 211 AKP+G V KCYA QSA R E PLE+ + GC R Sbjct: 101 AKPTGIVRAKCYAVQSATSRGR--ESPLEA-------------VGATSRISHGCIDR--- 142 Query: 212 XXXXXXXXXXXXDLIGTTHTTKMHLLFGSSSYKNSIVKRA*PGVILGWVT 361 THTTKMHLLFG+ + +NS VKRA PG ILGWVT Sbjct: 143 -------------FDWNTHTTKMHLLFGNQTLRNSKVKRAWPGEILGWVT 179 >XP_013443334.1 hypothetical protein MTR_0020s0050 [Medicago truncatula] KEH17359.1 hypothetical protein MTR_0020s0050 [Medicago truncatula] Length = 195 Score = 57.4 bits (137), Expect = 1e-07 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = -3 Query: 360 VTHPRITPGQARLTMEFL*DELPKRRCILVV*VVPIKSYQ 241 VTHP+I P QARLT+EFL +ELPKRRCIL++ VV SY+ Sbjct: 136 VTHPKIAPSQARLTVEFLWNELPKRRCILLILVVSNNSYK 175 >ABD63123.1 hypothetical protein 18.t00019 [Asparagus officinalis] Length = 153 Score = 53.5 bits (127), Expect = 2e-06 Identities = 25/33 (75%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = +2 Query: 104 EPPLESHTDGTVL-DVLWINEDVENLSGGGCNT 199 EPPLESHTDGTVL D++W NEDV +LSGG C+T Sbjct: 35 EPPLESHTDGTVLDDMIWHNEDVVSLSGGVCDT 67 >XP_003621188.1 hypothetical protein MTR_7g010230 [Medicago truncatula] AES77406.1 hypothetical protein MTR_7g010230 [Medicago truncatula] Length = 52 Score = 49.3 bits (116), Expect = 1e-05 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -3 Query: 360 VTHPRITPGQARLTMEFL*DELPKRRCILVV 268 VTHP I P QARLT+EFL +ELPKRRC L++ Sbjct: 22 VTHPEIAPSQARLTVEFLWNELPKRRCNLLI 52