BLASTX nr result
ID: Lithospermum23_contig00004517
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00004517 (242 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABB55329.1 hypothetical protein 12.t00047 [Asparagus officinalis] 62 1e-09 ABD63123.1 hypothetical protein 18.t00019 [Asparagus officinalis] 52 1e-06 >ABB55329.1 hypothetical protein 12.t00047 [Asparagus officinalis] Length = 304 Score = 62.4 bits (150), Expect = 1e-09 Identities = 30/40 (75%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = -1 Query: 197 VGYYNLPHLNTQRPR*ATT-HLGPYHPCEILEVAHTASRG 81 +GYY LPHLN+QRPR A + H PYHPCEILEVA TASRG Sbjct: 253 LGYYKLPHLNSQRPRYAKSYHPRPYHPCEILEVAPTASRG 292 >ABD63123.1 hypothetical protein 18.t00019 [Asparagus officinalis] Length = 153 Score = 52.4 bits (124), Expect = 1e-06 Identities = 25/33 (75%), Positives = 28/33 (84%), Gaps = 1/33 (3%) Frame = +2 Query: 98 EPPLESHTDGTVL-DVLWLNEDVEYLSGGGCNT 193 EPPLESHTDGTVL D++W NEDV LSGG C+T Sbjct: 35 EPPLESHTDGTVLDDMIWHNEDVVSLSGGVCDT 67