BLASTX nr result
ID: Lithospermum23_contig00004514
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00004514 (1315 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH45895.1 hypothetical protein GLYMA_08G300000 [Glycine max] 54 2e-06 >KRH45895.1 hypothetical protein GLYMA_08G300000 [Glycine max] Length = 46 Score = 54.3 bits (129), Expect = 2e-06 Identities = 25/41 (60%), Positives = 29/41 (70%) Frame = +1 Query: 130 TNHHKSF*HILSSLTCSLKNFPVDHPFHNCSSSNTLHLEML 252 TN HK+F H LSSLTC L+NFP HP HN S SN L+ +L Sbjct: 5 TNQHKNFQHALSSLTCFLRNFPKGHPSHNYSKSNMLNCGVL 45