BLASTX nr result
ID: Lithospermum23_contig00004159
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00004159 (453 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDO99450.1 unnamed protein product [Coffea canephora] 61 2e-09 XP_012848568.1 PREDICTED: pollen-specific leucine-rich repeat ex... 64 2e-09 XP_011095916.1 PREDICTED: pollen-specific leucine-rich repeat ex... 64 3e-09 XP_017615797.1 PREDICTED: protein spalten-like [Gossypium arboreum] 64 3e-09 XP_016711324.1 PREDICTED: pollen-specific leucine-rich repeat ex... 64 3e-09 XP_009796355.1 PREDICTED: uncharacterized protein LOC104242939 [... 63 3e-09 CDP21271.1 unnamed protein product [Coffea canephora] 61 3e-09 XP_009795883.1 PREDICTED: neurofilament heavy polypeptide-like [... 64 3e-09 XP_019223786.1 PREDICTED: neurofilament medium polypeptide-like ... 64 4e-09 XP_016717476.1 PREDICTED: brain acid soluble protein 1-like [Gos... 63 5e-09 CDP04524.1 unnamed protein product [Coffea canephora] 60 5e-09 XP_012454062.1 PREDICTED: pollen-specific leucine-rich repeat ex... 63 5e-09 CDP04521.1 unnamed protein product [Coffea canephora] 61 5e-09 XP_012454061.1 PREDICTED: histone H1-II-like isoform X1 [Gossypi... 63 6e-09 KZV57382.1 pollen-specific leucine-rich repeat extensin-like pro... 62 8e-09 XP_019263327.1 PREDICTED: pollen-specific leucine-rich repeat ex... 62 9e-09 XP_016457003.1 PREDICTED: IgA FC receptor [Nicotiana tabacum] 62 1e-08 XP_012841611.1 PREDICTED: pollen-specific leucine-rich repeat ex... 62 1e-08 EYU33837.1 hypothetical protein MIMGU_mgv1a027133mg [Erythranthe... 62 1e-08 XP_016447112.1 PREDICTED: pollen-specific leucine-rich repeat ex... 62 2e-08 >CDO99450.1 unnamed protein product [Coffea canephora] Length = 105 Score = 61.2 bits (147), Expect = 2e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 451 IRDQVYDEKANEVTITVVCCSPEKIRDKLC 362 IRDQVYDEK N VTITVVCCSPEKIRDKLC Sbjct: 33 IRDQVYDEKQNLVTITVVCCSPEKIRDKLC 62 >XP_012848568.1 PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 1 [Erythranthe guttata] EYU27661.1 hypothetical protein MIMGU_mgv1a012649mg [Erythranthe guttata] Length = 244 Score = 63.9 bits (154), Expect = 2e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 451 IRDQVYDEKANEVTITVVCCSPEKIRDKLC 362 IRDQVYDEKAN VTITVVCCSPEKIRDKLC Sbjct: 33 IRDQVYDEKANTVTITVVCCSPEKIRDKLC 62 >XP_011095916.1 PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 1 [Sesamum indicum] Length = 275 Score = 63.9 bits (154), Expect = 3e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 451 IRDQVYDEKANEVTITVVCCSPEKIRDKLC 362 IRDQVYDEKAN VTITVVCCSPEKIRDKLC Sbjct: 33 IRDQVYDEKANTVTITVVCCSPEKIRDKLC 62 >XP_017615797.1 PREDICTED: protein spalten-like [Gossypium arboreum] Length = 248 Score = 63.5 bits (153), Expect = 3e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 451 IRDQVYDEKANEVTITVVCCSPEKIRDKLC 362 IRDQ+YDEKAN VTITVVCCSPEKIRDKLC Sbjct: 33 IRDQIYDEKANTVTITVVCCSPEKIRDKLC 62 >XP_016711324.1 PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 2 [Gossypium hirsutum] Length = 256 Score = 63.5 bits (153), Expect = 3e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 451 IRDQVYDEKANEVTITVVCCSPEKIRDKLC 362 IRDQ+YDEKAN VTITVVCCSPEKIRDKLC Sbjct: 33 IRDQIYDEKANTVTITVVCCSPEKIRDKLC 62 >XP_009796355.1 PREDICTED: uncharacterized protein LOC104242939 [Nicotiana sylvestris] Length = 201 Score = 62.8 bits (151), Expect = 3e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 451 IRDQVYDEKANEVTITVVCCSPEKIRDKLC 362 IRDQVYDEKAN VTITVVCC+PEKIRDKLC Sbjct: 37 IRDQVYDEKANTVTITVVCCNPEKIRDKLC 66 >CDP21271.1 unnamed protein product [Coffea canephora] Length = 116 Score = 60.8 bits (146), Expect = 3e-09 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 451 IRDQVYDEKANEVTITVVCCSPEKIRDKLC 362 IRDQ+YDEK N VTITVVCCSPEKIRDKLC Sbjct: 33 IRDQIYDEKQNLVTITVVCCSPEKIRDKLC 62 >XP_009795883.1 PREDICTED: neurofilament heavy polypeptide-like [Nicotiana sylvestris] XP_016452438.1 PREDICTED: neurofilament heavy polypeptide-like [Nicotiana tabacum] Length = 271 Score = 63.5 bits (153), Expect = 3e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 451 IRDQVYDEKANEVTITVVCCSPEKIRDKLC 362 +RDQVYDEKAN VTITVVCCSPEKIRDKLC Sbjct: 37 VRDQVYDEKANTVTITVVCCSPEKIRDKLC 66 >XP_019223786.1 PREDICTED: neurofilament medium polypeptide-like [Nicotiana attenuata] OIT05741.1 hypothetical protein A4A49_02284 [Nicotiana attenuata] Length = 276 Score = 63.5 bits (153), Expect = 4e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 451 IRDQVYDEKANEVTITVVCCSPEKIRDKLC 362 +RDQVYDEKAN VTITVVCCSPEKIRDKLC Sbjct: 37 VRDQVYDEKANTVTITVVCCSPEKIRDKLC 66 >XP_016717476.1 PREDICTED: brain acid soluble protein 1-like [Gossypium hirsutum] Length = 233 Score = 62.8 bits (151), Expect = 5e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 451 IRDQVYDEKANEVTITVVCCSPEKIRDKLC 362 IRDQ+YDEKAN VTITVVCCSPEKIRDKLC Sbjct: 33 IRDQMYDEKANTVTITVVCCSPEKIRDKLC 62 >CDP04524.1 unnamed protein product [Coffea canephora] Length = 102 Score = 60.1 bits (144), Expect = 5e-09 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 451 IRDQVYDEKANEVTITVVCCSPEKIRDKLC 362 IRDQ+YDEK N VTITVVCCSPEKIRDKLC Sbjct: 33 IRDQMYDEKQNLVTITVVCCSPEKIRDKLC 62 >XP_012454062.1 PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 2 isoform X2 [Gossypium raimondii] KJB69158.1 hypothetical protein B456_011G008600 [Gossypium raimondii] Length = 245 Score = 62.8 bits (151), Expect = 5e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 451 IRDQVYDEKANEVTITVVCCSPEKIRDKLC 362 IRDQ+YDEKAN VTITVVCCSPEKIRDKLC Sbjct: 26 IRDQMYDEKANTVTITVVCCSPEKIRDKLC 55 >CDP04521.1 unnamed protein product [Coffea canephora] Length = 138 Score = 60.8 bits (146), Expect = 5e-09 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 451 IRDQVYDEKANEVTITVVCCSPEKIRDKLC 362 IRDQ+YDEK N VTITVVCCSPEKIRDKLC Sbjct: 32 IRDQIYDEKQNLVTITVVCCSPEKIRDKLC 61 >XP_012454061.1 PREDICTED: histone H1-II-like isoform X1 [Gossypium raimondii] KJB69156.1 hypothetical protein B456_011G008600 [Gossypium raimondii] Length = 252 Score = 62.8 bits (151), Expect = 6e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 451 IRDQVYDEKANEVTITVVCCSPEKIRDKLC 362 IRDQ+YDEKAN VTITVVCCSPEKIRDKLC Sbjct: 33 IRDQMYDEKANTVTITVVCCSPEKIRDKLC 62 >KZV57382.1 pollen-specific leucine-rich repeat extensin-like protein 1 [Dorcoceras hygrometricum] Length = 261 Score = 62.4 bits (150), Expect = 8e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 451 IRDQVYDEKANEVTITVVCCSPEKIRDKLC 362 IRDQVYDEKAN VTITVVCC PEKIRDKLC Sbjct: 34 IRDQVYDEKANTVTITVVCCDPEKIRDKLC 63 >XP_019263327.1 PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 1 [Nicotiana attenuata] Length = 272 Score = 62.4 bits (150), Expect = 9e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 451 IRDQVYDEKANEVTITVVCCSPEKIRDKLC 362 IRDQVYDEKAN VTITVVCC PEKIRDKLC Sbjct: 37 IRDQVYDEKANTVTITVVCCDPEKIRDKLC 66 >XP_016457003.1 PREDICTED: IgA FC receptor [Nicotiana tabacum] Length = 272 Score = 62.0 bits (149), Expect = 1e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 451 IRDQVYDEKANEVTITVVCCSPEKIRDKLC 362 IRDQVYDEKAN +TITVVCC PEKIRDKLC Sbjct: 37 IRDQVYDEKANTITITVVCCDPEKIRDKLC 66 >XP_012841611.1 PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 1 [Erythranthe guttata] Length = 236 Score = 61.6 bits (148), Expect = 1e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 451 IRDQVYDEKANEVTITVVCCSPEKIRDKLC 362 IRDQVYDEKAN VTI VVCCSPEKIRDKLC Sbjct: 12 IRDQVYDEKANTVTIIVVCCSPEKIRDKLC 41 >EYU33837.1 hypothetical protein MIMGU_mgv1a027133mg [Erythranthe guttata] Length = 238 Score = 61.6 bits (148), Expect = 1e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 451 IRDQVYDEKANEVTITVVCCSPEKIRDKLC 362 IRDQVYDEKAN VTI VVCCSPEKIRDKLC Sbjct: 14 IRDQVYDEKANTVTIIVVCCSPEKIRDKLC 43 >XP_016447112.1 PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 1 [Nicotiana tabacum] Length = 278 Score = 61.6 bits (148), Expect = 2e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 451 IRDQVYDEKANEVTITVVCCSPEKIRDKLC 362 +RDQVYDEKAN VTITVVCCSPE IRDKLC Sbjct: 37 VRDQVYDEKANTVTITVVCCSPENIRDKLC 66