BLASTX nr result
ID: Lithospermum23_contig00004004
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00004004 (282 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010110494.1 26S protease regulatory subunit S10B-B-like prote... 62 2e-09 XP_009372983.1 PREDICTED: 26S protease regulatory subunit 10B ho... 62 2e-09 XP_009351259.1 PREDICTED: 26S protease regulatory subunit 10B ho... 61 6e-09 XP_008382299.1 PREDICTED: 26S protease regulatory subunit 10B ho... 61 8e-09 KZM89626.1 hypothetical protein DCAR_023011 [Daucus carota subsp... 60 1e-08 XP_017214940.1 PREDICTED: 26S protease regulatory subunit 10B ho... 60 2e-08 ONH91056.1 hypothetical protein PRUPE_8G090700 [Prunus persica] 58 6e-08 ONH91055.1 hypothetical protein PRUPE_8G090700 [Prunus persica] 58 7e-08 ONH91054.1 hypothetical protein PRUPE_8G090700 [Prunus persica] 58 7e-08 XP_007199869.1 hypothetical protein PRUPE_ppa006011mg [Prunus pe... 58 7e-08 CDO97019.1 unnamed protein product [Coffea canephora] 58 1e-07 XP_009765027.1 PREDICTED: 26S protease regulatory subunit S10B h... 57 1e-07 XP_008364974.1 PREDICTED: 26S protease regulatory subunit 10B ho... 57 1e-07 XP_008236945.1 PREDICTED: 26S protease regulatory subunit S10B h... 57 3e-07 XP_009606963.1 PREDICTED: 26S protease regulatory subunit S10B h... 56 5e-07 ACJ84811.1 unknown, partial [Medicago truncatula] 55 6e-07 XP_012071930.1 PREDICTED: 26S protease regulatory subunit S10B h... 55 7e-07 XP_002283544.1 PREDICTED: 26S protease regulatory subunit S10B h... 55 7e-07 XP_004289648.1 PREDICTED: 26S protease regulatory subunit 10B ho... 55 7e-07 XP_019153354.1 PREDICTED: 26S protease regulatory subunit S10B h... 55 9e-07 >XP_010110494.1 26S protease regulatory subunit S10B-B-like protein [Morus notabilis] EXC26654.1 26S protease regulatory subunit S10B-B-like protein [Morus notabilis] Length = 399 Score = 62.4 bits (150), Expect = 2e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 181 MSTETEEAVRRRSATADYRKKLLQHKELDSRVR 279 MSTETE+AVRRR+ATADYRKKLL HKELDSRVR Sbjct: 1 MSTETEDAVRRRTATADYRKKLLHHKELDSRVR 33 >XP_009372983.1 PREDICTED: 26S protease regulatory subunit 10B homolog A [Pyrus x bretschneideri] XP_009348230.1 PREDICTED: LOW QUALITY PROTEIN: 26S protease regulatory subunit 10B homolog A-like [Pyrus x bretschneideri] Length = 399 Score = 62.4 bits (150), Expect = 2e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 181 MSTETEEAVRRRSATADYRKKLLQHKELDSRVR 279 MSTETE+AVRRR+A ADYRKKLLQHKELDSRVR Sbjct: 1 MSTETEDAVRRRTAVADYRKKLLQHKELDSRVR 33 >XP_009351259.1 PREDICTED: 26S protease regulatory subunit 10B homolog A-like [Pyrus x bretschneideri] Length = 399 Score = 61.2 bits (147), Expect = 6e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 181 MSTETEEAVRRRSATADYRKKLLQHKELDSRVR 279 M+TETE+AVRRR+A ADYRKKLLQHKELDSRVR Sbjct: 1 MTTETEDAVRRRTAVADYRKKLLQHKELDSRVR 33 >XP_008382299.1 PREDICTED: 26S protease regulatory subunit 10B homolog A [Malus domestica] Length = 399 Score = 60.8 bits (146), Expect = 8e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +1 Query: 181 MSTETEEAVRRRSATADYRKKLLQHKELDSRVR 279 MSTETE+A+RRR+A ADYRK+LLQHKELDSRVR Sbjct: 1 MSTETEDAIRRRTAVADYRKRLLQHKELDSRVR 33 >KZM89626.1 hypothetical protein DCAR_023011 [Daucus carota subsp. sativus] Length = 370 Score = 60.1 bits (144), Expect = 1e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 181 MSTETEEAVRRRSATADYRKKLLQHKELDSRVR 279 MS ETEEAVRRR ATADYRKKLLQHKEL+SRVR Sbjct: 1 MSGETEEAVRRRVATADYRKKLLQHKELESRVR 33 >XP_017214940.1 PREDICTED: 26S protease regulatory subunit 10B homolog A [Daucus carota subsp. sativus] Length = 399 Score = 60.1 bits (144), Expect = 2e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 181 MSTETEEAVRRRSATADYRKKLLQHKELDSRVR 279 MS ETEEAVRRR ATADYRKKLLQHKEL+SRVR Sbjct: 1 MSGETEEAVRRRVATADYRKKLLQHKELESRVR 33 >ONH91056.1 hypothetical protein PRUPE_8G090700 [Prunus persica] Length = 292 Score = 58.2 bits (139), Expect = 6e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 181 MSTETEEAVRRRSATADYRKKLLQHKELDSRVR 279 M+TE E+AVRRR+A ADYRK+LLQHKELDSRVR Sbjct: 1 MTTEAEDAVRRRTAVADYRKRLLQHKELDSRVR 33 >ONH91055.1 hypothetical protein PRUPE_8G090700 [Prunus persica] Length = 381 Score = 58.2 bits (139), Expect = 7e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 181 MSTETEEAVRRRSATADYRKKLLQHKELDSRVR 279 M+TE E+AVRRR+A ADYRK+LLQHKELDSRVR Sbjct: 1 MTTEAEDAVRRRTAVADYRKRLLQHKELDSRVR 33 >ONH91054.1 hypothetical protein PRUPE_8G090700 [Prunus persica] Length = 399 Score = 58.2 bits (139), Expect = 7e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 181 MSTETEEAVRRRSATADYRKKLLQHKELDSRVR 279 M+TE E+AVRRR+A ADYRK+LLQHKELDSRVR Sbjct: 1 MTTEAEDAVRRRTAVADYRKRLLQHKELDSRVR 33 >XP_007199869.1 hypothetical protein PRUPE_ppa006011mg [Prunus persica] Length = 432 Score = 58.2 bits (139), Expect = 7e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 181 MSTETEEAVRRRSATADYRKKLLQHKELDSRVR 279 M+TE E+AVRRR+A ADYRK+LLQHKELDSRVR Sbjct: 34 MTTEAEDAVRRRTAVADYRKRLLQHKELDSRVR 66 >CDO97019.1 unnamed protein product [Coffea canephora] Length = 399 Score = 57.8 bits (138), Expect = 1e-07 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = +1 Query: 181 MSTETEEAVRRRSATADYRKKLLQHKELDSRVRT 282 MS ETE+AVRR++A+A+YRKKLLQHKEL+SRVRT Sbjct: 1 MSGETEDAVRRKTASAEYRKKLLQHKELESRVRT 34 >XP_009765027.1 PREDICTED: 26S protease regulatory subunit S10B homolog B [Nicotiana sylvestris] XP_016439298.1 PREDICTED: 26S protease regulatory subunit S10B homolog B-like [Nicotiana tabacum] XP_019232980.1 PREDICTED: 26S protease regulatory subunit S10B homolog B [Nicotiana attenuata] OIT07483.1 26s protease regulatory subunit s10b -like b [Nicotiana attenuata] Length = 398 Score = 57.4 bits (137), Expect = 1e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +1 Query: 181 MSTETEEAVRRRSATADYRKKLLQHKELDSRVRT 282 MSTE EEAVRRR+A ADYRKKLLQHKELD+RVRT Sbjct: 1 MSTE-EEAVRRRTALADYRKKLLQHKELDARVRT 33 >XP_008364974.1 PREDICTED: 26S protease regulatory subunit 10B homolog A [Malus domestica] Length = 399 Score = 57.4 bits (137), Expect = 1e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 181 MSTETEEAVRRRSATADYRKKLLQHKELDSRVR 279 M+TETE+AVRRR+A ADYRK+LLQHKEL SRVR Sbjct: 1 MTTETEDAVRRRTAVADYRKRLLQHKELKSRVR 33 >XP_008236945.1 PREDICTED: 26S protease regulatory subunit S10B homolog B [Prunus mume] Length = 399 Score = 56.6 bits (135), Expect = 3e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 181 MSTETEEAVRRRSATADYRKKLLQHKELDSRVR 279 M+TE E+ VRRR+A ADYRK+LLQHKELDSRVR Sbjct: 1 MTTEAEDVVRRRTAVADYRKRLLQHKELDSRVR 33 >XP_009606963.1 PREDICTED: 26S protease regulatory subunit S10B homolog B [Nicotiana tomentosiformis] XP_016496925.1 PREDICTED: 26S protease regulatory subunit S10B homolog B-like [Nicotiana tabacum] Length = 398 Score = 55.8 bits (133), Expect = 5e-07 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +1 Query: 181 MSTETEEAVRRRSATADYRKKLLQHKELDSRVRT 282 MSTE EEA RRR+A ADYRKKLLQHKELD+RVRT Sbjct: 1 MSTE-EEAARRRTALADYRKKLLQHKELDARVRT 33 >ACJ84811.1 unknown, partial [Medicago truncatula] Length = 236 Score = 55.1 bits (131), Expect = 6e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +1 Query: 181 MSTETEEAVRRRSATADYRKKLLQHKELDSRVRT 282 MS TE+AVRRR+A A+YRKKLLQHKEL+SRVR+ Sbjct: 1 MSDTTEDAVRRRNAVAEYRKKLLQHKELESRVRS 34 >XP_012071930.1 PREDICTED: 26S protease regulatory subunit S10B homolog B [Jatropha curcas] KDP38557.1 hypothetical protein JCGZ_04482 [Jatropha curcas] Length = 399 Score = 55.5 bits (132), Expect = 7e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 181 MSTETEEAVRRRSATADYRKKLLQHKELDSRVR 279 MSTE E+A RRR+A +DYRKKLLQHKEL+SRVR Sbjct: 1 MSTEGEDAARRRNAVSDYRKKLLQHKELESRVR 33 >XP_002283544.1 PREDICTED: 26S protease regulatory subunit S10B homolog B [Vitis vinifera] CBI37694.3 unnamed protein product, partial [Vitis vinifera] Length = 399 Score = 55.5 bits (132), Expect = 7e-07 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +1 Query: 181 MSTETEEAVRRRSATADYRKKLLQHKELDSRVRT 282 M++E E+AVRRR+ T DYRKKLLQHKEL+SRVR+ Sbjct: 1 MASEAEDAVRRRTTTTDYRKKLLQHKELESRVRS 34 >XP_004289648.1 PREDICTED: 26S protease regulatory subunit 10B homolog A [Fragaria vesca subsp. vesca] Length = 400 Score = 55.5 bits (132), Expect = 7e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 184 STETEEAVRRRSATADYRKKLLQHKELDSRVR 279 STETE+AVRRR+A +YRK+LLQHKELDSRVR Sbjct: 3 STETEDAVRRRNAVNEYRKRLLQHKELDSRVR 34 >XP_019153354.1 PREDICTED: 26S protease regulatory subunit S10B homolog B [Ipomoea nil] Length = 398 Score = 55.1 bits (131), Expect = 9e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 187 TETEEAVRRRSATADYRKKLLQHKELDSRVRT 282 +E E+AVRRR+A ADYRKKLLQHKELDSR+RT Sbjct: 2 SEGEDAVRRRTALADYRKKLLQHKELDSRLRT 33