BLASTX nr result
ID: Lithospermum23_contig00002044
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00002044 (234 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011087429.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 65 2e-11 EPS60935.1 induced stolon tip protein [Genlisea aurea] 64 3e-11 XP_012844705.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 64 5e-11 ACM68451.1 stress-associated protein 1, partial [Solanum pennellii] 62 6e-11 AAR83854.1 induced stolon tip protein [Capsicum annuum] 62 6e-11 XP_019414165.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 64 8e-11 XP_011093526.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 64 1e-10 XP_012849801.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 64 1e-10 XP_004306522.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 63 1e-10 XP_008375146.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 63 2e-10 KMT14452.1 hypothetical protein BVRB_4g072280 [Beta vulgaris sub... 63 2e-10 XP_009365003.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 63 2e-10 XP_009365002.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 63 2e-10 XP_008349960.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 63 2e-10 ACR56824.1 At3g12630-like protein, partial [Solanum hirtum] 62 2e-10 XP_017244698.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 62 2e-10 ACR56827.1 At3g12630-like protein, partial [Solanum hirtum] 62 2e-10 KZV50293.1 stress-associated protein 1 [Dorcoceras hygrometricum] 62 3e-10 XP_019264254.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 62 3e-10 XP_009773992.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 62 3e-10 >XP_011087429.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Sesamum indicum] Length = 170 Score = 65.1 bits (157), Expect = 2e-11 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = +2 Query: 110 EASLISNFPMKRKVNRCTGCYKKVGLTGIRCRCGKLFCSNH 232 EA+ + P+KR+VNRC+GC +KVGLTG RCRCG+LFC++H Sbjct: 95 EAAEVEAPPVKRQVNRCSGCRRKVGLTGFRCRCGELFCADH 135 >EPS60935.1 induced stolon tip protein [Genlisea aurea] Length = 156 Score = 64.3 bits (155), Expect = 3e-11 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +2 Query: 107 SEASLISNFPMKRKVNRCTGCYKKVGLTGIRCRCGKLFCSNH 232 +EA + P++R VNRC+GC KKVGLTG RCRCG+LFC+ H Sbjct: 80 TEAEAAAARPLERSVNRCSGCRKKVGLTGFRCRCGELFCAEH 121 >XP_012844705.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Erythranthe guttata] EYU31355.1 hypothetical protein MIMGU_mgv1a014767mg [Erythranthe guttata] Length = 179 Score = 64.3 bits (155), Expect = 5e-11 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +2 Query: 134 PMKRKVNRCTGCYKKVGLTGIRCRCGKLFCSNH 232 P KR+VNRCTGC +KVGLTG RCRCG+LFC++H Sbjct: 112 PAKREVNRCTGCRRKVGLTGFRCRCGELFCADH 144 >ACM68451.1 stress-associated protein 1, partial [Solanum pennellii] Length = 87 Score = 62.0 bits (149), Expect = 6e-11 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +2 Query: 134 PMKRKVNRCTGCYKKVGLTGIRCRCGKLFCSNH 232 P KR+VNRC+GC +KVGLTG RCRCG+LFC H Sbjct: 20 PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH 52 >AAR83854.1 induced stolon tip protein [Capsicum annuum] Length = 88 Score = 62.0 bits (149), Expect = 6e-11 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +2 Query: 134 PMKRKVNRCTGCYKKVGLTGIRCRCGKLFCSNH 232 P KR+VNRC+GC +KVGLTG RCRCG+LFC H Sbjct: 21 PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH 53 >XP_019414165.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Lupinus angustifolius] OIV98978.1 hypothetical protein TanjilG_29381 [Lupinus angustifolius] Length = 166 Score = 63.5 bits (153), Expect = 8e-11 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = +2 Query: 110 EASLISNFPMKRKVNRCTGCYKKVGLTGIRCRCGKLFCSNH 232 + S+ ++F KR VNRC+GC K+VGLTG RCRCG LFCS H Sbjct: 91 QRSVTASFEAKRVVNRCSGCRKRVGLTGFRCRCGDLFCSEH 131 >XP_011093526.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5 [Sesamum indicum] Length = 177 Score = 63.5 bits (153), Expect = 1e-10 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +2 Query: 134 PMKRKVNRCTGCYKKVGLTGIRCRCGKLFCSNH 232 P+KR+VNRC+GC +KVGLTG RCRCG+LFC++H Sbjct: 110 PVKREVNRCSGCRRKVGLTGFRCRCGELFCADH 142 >XP_012849801.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Erythranthe guttata] EYU27075.1 hypothetical protein MIMGU_mgv1a014771mg [Erythranthe guttata] Length = 178 Score = 63.5 bits (153), Expect = 1e-10 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = +2 Query: 95 KLANSEASLISNFPMKRKVNRCTGCYKKVGLTGIRCRCGKLFCSNH 232 KL +S A+ + P+KR+VNRC+GC +KVGLTG RCRCG LFC++H Sbjct: 99 KLDDSPAAEAA-LPLKREVNRCSGCRRKVGLTGFRCRCGDLFCADH 143 >XP_004306522.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5 [Fragaria vesca subsp. vesca] Length = 170 Score = 63.2 bits (152), Expect = 1e-10 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = +2 Query: 101 ANSEASLISNFPMKRKVNRCTGCYKKVGLTGIRCRCGKLFCSNH 232 A++E++ M+R VNRC+GC +KVGLTG RCRCG+LFCS H Sbjct: 92 ASAESTRSEESSMRRVVNRCSGCRRKVGLTGFRCRCGELFCSEH 135 >XP_008375146.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Malus domestica] Length = 165 Score = 62.8 bits (151), Expect = 2e-10 Identities = 27/46 (58%), Positives = 32/46 (69%) Frame = +2 Query: 95 KLANSEASLISNFPMKRKVNRCTGCYKKVGLTGIRCRCGKLFCSNH 232 K SE + P +R VNRC+GC +KVGLTG RCRCG+LFCS H Sbjct: 85 KTTASEIARSDESPNRRVVNRCSGCRRKVGLTGFRCRCGELFCSEH 130 >KMT14452.1 hypothetical protein BVRB_4g072280 [Beta vulgaris subsp. vulgaris] Length = 168 Score = 62.8 bits (151), Expect = 2e-10 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = +2 Query: 116 SLISNFPMKRKVNRCTGCYKKVGLTGIRCRCGKLFCSNH 232 S +S P+K+ VNRC+GC K+VGLTG RCRCG LFC++H Sbjct: 95 SSVSTNPVKKAVNRCSGCGKRVGLTGFRCRCGDLFCADH 133 >XP_009365003.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5 isoform X2 [Pyrus x bretschneideri] XP_018504842.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5 isoform X3 [Pyrus x bretschneideri] Length = 168 Score = 62.8 bits (151), Expect = 2e-10 Identities = 27/46 (58%), Positives = 32/46 (69%) Frame = +2 Query: 95 KLANSEASLISNFPMKRKVNRCTGCYKKVGLTGIRCRCGKLFCSNH 232 K SE + P +R VNRC+GC +KVGLTG RCRCG+LFCS H Sbjct: 88 KTTASEIARSDETPNRRVVNRCSGCRRKVGLTGFRCRCGELFCSEH 133 >XP_009365002.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5 isoform X1 [Pyrus x bretschneideri] Length = 168 Score = 62.8 bits (151), Expect = 2e-10 Identities = 27/46 (58%), Positives = 32/46 (69%) Frame = +2 Query: 95 KLANSEASLISNFPMKRKVNRCTGCYKKVGLTGIRCRCGKLFCSNH 232 K SE + P +R VNRC+GC +KVGLTG RCRCG+LFCS H Sbjct: 88 KTTASEIARSDETPNRRVVNRCSGCRRKVGLTGFRCRCGELFCSEH 133 >XP_008349960.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Malus domestica] XP_008349986.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Malus domestica] Length = 169 Score = 62.8 bits (151), Expect = 2e-10 Identities = 27/46 (58%), Positives = 32/46 (69%) Frame = +2 Query: 95 KLANSEASLISNFPMKRKVNRCTGCYKKVGLTGIRCRCGKLFCSNH 232 K SE + P +R VNRC+GC +KVGLTG RCRCG+LFCS H Sbjct: 89 KTTASEIARSDETPNRRVVNRCSGCRRKVGLTGFRCRCGELFCSEH 134 >ACR56824.1 At3g12630-like protein, partial [Solanum hirtum] Length = 147 Score = 62.0 bits (149), Expect = 2e-10 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +2 Query: 134 PMKRKVNRCTGCYKKVGLTGIRCRCGKLFCSNH 232 P KR+VNRC+GC +KVGLTG RCRCG+LFC H Sbjct: 86 PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH 118 >XP_017244698.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Daucus carota subsp. sativus] Length = 150 Score = 62.0 bits (149), Expect = 2e-10 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +2 Query: 134 PMKRKVNRCTGCYKKVGLTGIRCRCGKLFCSNH 232 P+K++VNRC+GC +KVGLTGIRCRCG+LFC H Sbjct: 83 PVKKEVNRCSGCRRKVGLTGIRCRCGELFCPAH 115 >ACR56827.1 At3g12630-like protein, partial [Solanum hirtum] Length = 151 Score = 62.0 bits (149), Expect = 2e-10 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +2 Query: 134 PMKRKVNRCTGCYKKVGLTGIRCRCGKLFCSNH 232 P KR+VNRC+GC +KVGLTG RCRCG+LFC H Sbjct: 90 PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH 122 >KZV50293.1 stress-associated protein 1 [Dorcoceras hygrometricum] Length = 175 Score = 62.4 bits (150), Expect = 3e-10 Identities = 27/44 (61%), Positives = 37/44 (84%) Frame = +2 Query: 101 ANSEASLISNFPMKRKVNRCTGCYKKVGLTGIRCRCGKLFCSNH 232 A++EA+L P+KR+VNRC+GC +KVGLTG RCRCG+L C++H Sbjct: 100 ASTEAALP---PVKREVNRCSGCRRKVGLTGFRCRCGELLCADH 140 >XP_019264254.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Nicotiana attenuata] OIT36576.1 zinc finger a20 and an1 domain-containing stress-associated protein 5 [Nicotiana attenuata] Length = 158 Score = 62.0 bits (149), Expect = 3e-10 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +2 Query: 134 PMKRKVNRCTGCYKKVGLTGIRCRCGKLFCSNH 232 P KR+VNRC+GC +KVGLTG RCRCG+LFC H Sbjct: 91 PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH 123 >XP_009773992.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Nicotiana sylvestris] XP_016487465.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Nicotiana tabacum] Length = 158 Score = 62.0 bits (149), Expect = 3e-10 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +2 Query: 134 PMKRKVNRCTGCYKKVGLTGIRCRCGKLFCSNH 232 P KR+VNRC+GC +KVGLTG RCRCG+LFC H Sbjct: 91 PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH 123